current user: public
If you have questions about the server, please let us know.

Query: d3ldqb1 a.7.7.1 (B:151-260) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst NSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQLast
1 -5.330IDP91681 LAMC3_HUMAN [Homo sapiens]  ali follow..  7 1437...RASRLTSQTQATLQQASQQVLASEARRQELEEAERVGAGLSEMEQQIRESRISLEKDIETLSELLARLGSLDTHQAPAQALNETQWALERLRLQLGSPGSLQRKLSL 1543
2 -5.290IDP06025 intraflagellar transport protein component IFT74/72, putative [Toxoplasma gondii ME49] EEB00214 [Toxoplasma gondii ME49]  ali follow..  7  66..............LKEKHRDLRREIGKFQAQIEVLSREAEQLPMMRRRKRELEKEIEELQEKIAVINSAVTLGRENLRPEVVAATAREVKEKNETKRALLDEL...... 155
3 -5.280IDP01947 gene: zntB; zinc transporter [Salmonella typhimurium LT2] STM1656 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  13  151..............CDALTDHASEFIEELHDKIIDLEDNLLDQQIPPGFLALLRKQLIVMRRYMADVYARLASERLPWMSDDHRRRMQDIADRLGRGLDEIDACIARTG. 249
4 -5.230IDP05339 gene: glyS; glycyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] SACOL1622 [Staphylococcus aureus subsp. aureus COL]  ali follow..  9  368...........LAPYKAAILPLSKKLSGEAIKIFEQLSS--KFSIDFDESQSIGKRYRRQDEIGTPYCVTFDFDSLEDNQVTVR-DRDSMEQVRMPISELEAFLTEKTK. 462
5 -5.160IDP00491 heat shock protein GrpE YPO1107 [Yersinia pestis CO92]  ali follow..  11  44..................................................VQLSDALQRERESLLRAKAEVENIRRRTELDVEKAHKFALERFSSELLPVIDNLERALD. 102
6 -5.120IDP00879 gene: yaeH; putative cytoplasmic protein STM0211 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  10  67......................................................KEVQEISPNLRYVIDELDQIQRDRSELDLKRKILDDLRHLESVVNKISEIEADLDK 124
7 -5.110IDP02360 gene: grpE; heat shock protein GrpE [Francisella tularensis subsp. tularensis SCHU S4] FTT1270c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  14  46..............................................KDTIKELEDSCDQFKDEALRAKAEMENIRKRAERDVSNARKFGIEKFSKELLPVIDSIEQALKH 109
8 -5.060IDP02301 cell entry (mce) related family protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1249 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  6  130....KKGQIPEITSKPSQLESIMNKVSAIASSLEEISGKFMMSPENLDRFNQFTDSINILLYNLSNSSIYFNKT---MNLNETMTESQETITRLNNVIRILEYDPSTIVR 235
9 -4.990IDP05146 glycyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS4784 [Bacillus anthracis str. Sterne]  ali follow..  10  354.........RTVLRFHPALAPYKAAILPLSKKLSEGATEVFAE-VDFDETGSIGKRYRRQDEIGTPFCITYDFDSVEDKAVTVRD-RDTMEQVRMPISELKGFLEKKIQ. 457
10 -4.930IDP01403 heat shock protein GrpE VC0854 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  51..............................................EAALLVSEERVKEQQDSVLRARAEVENMRRRSEQEVDKARKFALSRFAEELLPVIDNLERAIQ. 113
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 7 0 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang B, Jaroszewski L, Rychlewski L, Godzik A. Similarities and differences between nonhomologous proteins with similar folds: evaluation of threading strategies. Fold Des. 1997;2(5):307-17.