current user: public

If you have questions about the server, please let us know.

Query: d4hswa_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}, from SCOP207

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst GFKQDIATIRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKSDQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKFFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMKLast
1 -32.600IDP01484 nitric oxide dioxygenase VCA0183 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  10.IKSTIPLLESAGPALTQHFYQRMFSHNPELKHIFN----------MTHQKTGRQSVALFEAIAAYAKHIDNLAALTSAVERIAHKHTSFNIQPEHYQIVGHHLLETLREAFTQPVEEAWTAAYFFLAQVFIDREGA 139
2 -31.900IDP00562 gene: hmp; nitric oxide dioxygenase YPO2908 [Yersinia pestis CO92]  ali follow..  12  10.VKSTIPLLAATGPKLTAHFYERMFKHHPELKNIFN----------MSNQSSGDQREALFNAICAYATNIENLAALLPTVERIAQKHTSLNIQPEHYPIVGEHLIATLDELFGQAVLDAWAKAYGVLADVFIQRESQ 137
3 -31.300IDP00644 flavohemoprotein, putative SACOL0220 [Staphylococcus aureus subsp. aureus COL]  ali follow..  10.IKQTVPLLKEKGTEITSIFYPKMFKAHPELLNMFN----------QTNQKRGMQSSALAQAVMAAAVNIDNLSVIKPVIMPVAYKHCALQVYAEHYPIVGKNLLKAIQDVENDPVIQAWAKAYGVIADVFIQIEKE 139
4 -6.220IDP06380 gene: ORF46; ORF46 [Human herpesvirus 8] YP_001129398 [Human herpesvirus 8]  ali follow..  14  27.LAPKWISF--SLSSFLKQKLLSLLRQYPPQDKLMWWSHCCDPEDIK--GQDPYHKGQATGLAFSVDPQCQVPPSLRSIFRELEASHGCLDSWARQGVLLLNTVLTVEKGRAGSHEGLGWDWFTSFIISSISS.... 177
5 -5.710IDP01109 hypothetical protein GBAA_pXO1_0148 GBAA_pXO1_0148 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  1............MEATKRYLCLYLKESQEKFISNWKKRILVHEHDP-YKNEIIKNGTHLLHVFTMYMREEINLQDIEDISKKIAQERMDAKVNIADTNEGKKEILNTLFLLNPTGQEEQINLFFDHLIYSTIYSYYK 133
6 -5.100IDP01603 gene: fliH; flagellar assembly protein H [Salmonella typhimurium LT2] STM1971 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  82GLAQGLEQGQAQAQTQQAPIHARMQQLVSEFQNTLDALDSVIASRLMQGQTPAVDNSALIKQIQQLLQQEDDLQRVEEMLGATLSL-HGWRLRGDPTLHHGGCKVSADEGDLDASVATRWQELCRLAAPGVL..... 235
7 -4.980IDP90142 unknown [Monkeypox virus] MPXV_ZAI1979_005_188 [Monkeypox virus]  ali follow..  35....YWSSYAYRNRQCAGQLYGTLLSFKDDAESVFIDVRELVKNMPWDN--VKDCTEIIRCYIPDEQKTIREISAIIGLCAYAATYWGGEDHPTSNSLNALFVMLGMLNY........................... 138
8 -4.810IDP02504 gene: ung; uracil-DNA glycosylase [Francisella tularensis subsp. tularensis SCHU S4] FTT1578c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  10  2....TWSDILAE--EKQKPYFKQILDFFPTKENIFNAFKYTELDNLK--GQDPYHNYNQAHGLAFSVKGVDIPPSLQNIYKELARNHGYLVDWAKQGVFLLNTTLTVEAHKANSHKDIGWETFTDTVINKISE.... 150
9 -4.800IDP91510 putative type III secretion protein [Vibrio parahaemolyticus RIMD 2210633] VP1664 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  10  1...................MMTRVSTLNVGIEAFTHVSHGEVDTDFPKRFQLLPDGQAVATHLEKLYDLRPSDQYLLALAKPKLNHCE---LRPEKYRQQFDNTLARVQQLAQESGSANLAKAAETLQSTQL..... 111
10 -4.760IDP90973 RTX toxin RtxA [Vibrio sp. AND4] AND4_00045 [Vibrio sp. AND4]  ali follow..  405GINNA--TTGRSSNPEPAIVFE--FRTIPSDLTEFVPRKECAKLNVQALDEFVPADRRITTEVNTIVQSSDDFDSVKNPKTAASINQKAEWVMTQK--------------------PAEWDRI.............. 517

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.