current user: public

If you have questions about the server, please let us know.

Query: d4i0va_ a.1.1.1 (A:) automated matches {Synechococcus sp. [TaxId: 32049]}, from SCOP207

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVQHRNDVLNRLast
1 -7.910IDP92744 hypothetical protein lpp1221 [Legionella pneumophila str. Paris] YP_123545 [Legionella pneumophila str. Paris]  ali follow..  12  48......VGGQPD---------GPLDKSTHKPTLW---------EKNTHCTAECLAWRGHWVAEERRRRENDLGETIYFGTPYYARWLLAMAKMLLDKGY---TPDELMNKMAEVRKREEI... 141
2 -6.350IDP06490 gene: D19L; D19L [Monkeypox virus Zaire-96-I-16] NP_536449 [Monkeypox virus Zaire-96-I-16]  ali follow..  10  95.AILDKMTADIKLTDLVRHYFRYIEQDIPLGPLFKKID--SYRIRAINNYSKELGLATEYFNKYGHLMFYTLPIPYN---RNSIGFLAVLSPTIGYVKAFYKFI-EYVSIDDRRKFKKELMSK 214
3 -5.690IDP91463 bacteriophage phi gp55-like protein [Vibrio vulnificus CMCP6] VV1_0079 [Vibrio vulnificus CMCP6]  ali follow..  10  22.QTLKDYGHNETVEQHLNKRPGVLLNEINPNQTSHKLGLFDAIKQILRSIASELNHSIYFLGDYRAISDMELLNCYSRWHAEIGDVNRAIADALEDGDIERHEFDRIERELQETFAAALEL.. 149
4 -5.470IDP00562 gene: hmp; nitric oxide dioxygenase YPO2908 [Yersinia pestis CO92]  ali follow..  17  18.........AATGPKLTAHFYERMFKHPELKNIFNMSNQSSGDQREALFNAICAYATNIENLAALLPTVERIHTSLNIQPEHYPIVGEHLIATLDEL.......................... 109
5 -5.420IDP01484 nitric oxide dioxygenase VCA0183 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  18.........ESAGPALTQHFYQRMFSNPELKHIFNMTHQKTGRQSVALFEAIAAYAKHIDNLAALTSAVERIHTSFNIQPEHYQIVGHHLLETLRELAPDAFTQPVEEAWTAAYFFLAQVF.. 133
6 -5.050IDP06320 gene: folE; GTP cyclohydrolase I [Streptococcus pneumoniae TIGR4] NP_344829 [Streptococcus pneumoniae TIGR4]  ali follow..  14  94....GRVAGLSKLARTVEVYSKKPQIQERLNIEVADALMDYLGAKEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYRLMGL.................................. 184
7 -4.910IDP06160 gene: folE; GTP cyclohydrolase I [Helicobacter pylori J99] NP_223581 [Helicobacter pylori J99]  ali follow..  14  90....EKIVGISAIAKLIEIYSKRLQIQERLTTQIAETFDEIIEPREAKHLCMSMQGVQKQNAIIKTSVLRGLFKKDPKTRAEFMQLLK................................... 179
8 -4.880IDP01647 gene: folE; GTP cyclohydrolase I [Coxiella burnetii RSA 493] CBU_0795 [Coxiella burnetii RSA 493]  ali follow..  94....GKIIGISKLARIVDMFAKRLQVQENLTKQIAEAILTATEAKEAKHLCMMMRGVEKQNSEMTTSVMLGTFRKDDRTRSEFLSLIR................................... 183
9 -4.830IDP92708 ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] ABD21354 [Staphylococcus aureus subsp. aureus USA300_FPR3757]  ali follow..  72PKLYDNKSGLYNLK-LFAQVLGKGFDKAYTDKIIDAFGMRPYIKKKVKKYSM---GMKQKLAIAVSLMNKPKFLTNGMDPDGSIDVLTTIKSLVNELDMRILISSHKLEDIELICDRAVFLRD 195
10 -4.810IDP92592 heat shock protein 70, putative [Toxoplasma gondii ME49] TGME49_073760 [Toxoplasma gondii ME49]  ali follow..  12  227....THLGGEDFDNRLVDFCVQDFKRKNRGKDISTNSRALRRLRTQCERTKRTLSSSTQAT--EIDSLFEGIDYSVSISRARFEELLLPVEKVLKDSGIDKRSVSEVVLVGGSTR........ 344

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.