current user: public

If you have questions about the server, please let us know.

Query: d2bkma_ a.1.1.1 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}, from SCOP207

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst EQWQTLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPDDLTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAHHMVNTPDHLDLast
1 -8.480sp|Q9NPG2|NGB_HUMAN Neuroglobin OS=Homo sapiens GN=NGB PE=1 SV=1  ali follow..  11  17............SRSPLEHGTVLFARLALEPDLLPLFQPEFLDHIRKVMLVIDAAVTNVEDLSS----ASLGRKHRAVGVKLSSFSTVGESLLYMLEKCAFTPATRAAWSQLYGAVVQAMSRGWDGE. 151
2 -7.070sp|P69891|HBG1_HUMAN Hemoglobin subunit gamma-1 OS=Homo sapiens GN=HBG1 PE=1 SV=2  ali follow..  6EEDKATITSLWGKVNVEDAGGETLGRLVVYPWTQRFFDPKVKAHGKKVLTSLGDAIKH----LKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHEFTPEVQASWQKMVTAVASALSSR..... 145
3 -6.990sp|P69892|HBG2_HUMAN Hemoglobin subunit gamma-2 OS=Homo sapiens GN=HBG2 PE=1 SV=2  ali follow..  6EEDKATITSLWGKVNVEDAGGETLGRLVVYPWTQRFFDPKVKAHGKKVLTSLGDAIKHLDDLKG----QLSELHCDKLHVDPENFKLLGNVLVTVLAIHEFTPEVQASWQKMVTGVASALSSR..... 145
4 -6.670sp|P02100|HBE_HUMAN Hemoglobin subunit epsilon OS=Homo sapiens GN=HBE1 PE=1 SV=2  ali follow..  6AEEKAAVTSLWSKMNVEEAGGEALGRLVVYPWTQRFFDSKVKAHGKKVLTSFGDAIKNMDNLKP---AKLSELHCDKLHVDPENFKLLGNVMVIILATHEFTPEVQAAWQKLVSAVAIALAHKYH... 147
5 -6.280sp|P02042|HBD_HUMAN Hemoglobin subunit delta OS=Homo sapiens GN=HBD PE=1 SV=2  ali follow..  12  6PEEKTAVNALWGKVNVDAVGGEALGRLVVYPWTQRFFESDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKSELHCDKLHVDPENFRLLGNVLVCVLARNEFTPQMQAAYQKVVAGVANALAHK..... 145
6 -6.270sp|P36776|LONM_HUMAN(removed signalp:1-16) Lon protease homolog, mitochondrial OS=Homo sapiens GN=LONP1 PE=1 SV=2  ali   178HELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQ--------------EQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSE... 288
7 -6.180sp|Q8NE09|RGS22_HUMAN Regulator of G-protein signaling 22 OS=Homo sapiens GN=RGS22 PE=2 SV=3  ali   11  211...................MENLLQSLYVENRAGFFFTKFCEHSGNKLWKNSVYFWFDLQAYHQQETLQPFKVCKQAQYL----FATYVA--PSATLDIGLQQEKKKEIYMK................ 300
8 -6.170sp|Q9UBU8|MO4L1_HUMAN Mortality factor 4-like protein 1 OS=Homo sapiens GN=MORF4L1 PE=1 SV=2  ali follow..  11  222........YLPAKKNVDSILEDYANYKKSRGNTDN--EYAVNEVVAGIKEYFNVMLGTQLLYKERPQYAEILADHPDAPMSQPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSAT.. 343
9 -5.990sp|Q15014|MO4L2_HUMAN Mortality factor 4-like protein 2 OS=Homo sapiens GN=MORF4L2 PE=1 SV=1  ali follow..  10  148........QLPAKKNVDAILEEYANCKKSQGNVDN--EYAVNEVVAGIKEYFNVMLGTQLLYKERPQYAEILLAHPDAPMSQPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSAS.. 269
10 -5.880sp|Q8NE09|RGS22_HUMAN Regulator of G-protein signaling 22 OS=Homo sapiens GN=RGS22 PE=2 SV=3  ali   11  61...................MENLLQSLYVENRAGFFFTKFCEHSGNKLWKNSVYFWFDLQAYHQLFYQETLQPFKVCKQAQY--FATYVA--PSATLDIGLQQEKKKEIYMKIQPPFEDLFDTAEEY. 165

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.