current user: public

If you have questions about the server, please let us know.

Query: d2gkma_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}, from SCOP207

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst GLLSRLRKREPISIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSLast
1 -8.140sp|P69891|HBG1_HUMAN Hemoglobin subunit gamma-1 OS=Homo sapiens GN=HBG1 PE=1 SV=2  ali follow..  13  4..FTEEDKATITSLWGKVNVEDAGGETLGRLLV---VYPWTQRFFDNPKVKAHGKKVLTSLGDALDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHEFTPEVQASWQKMVTAVASALSS 144
2 -8.130sp|Q9NPG2|NGB_HUMAN Neuroglobin OS=Homo sapiens GN=NGB PE=1 SV=1  ali follow..  16  17....................SRSPLEHGTVLFARLFAEPDLLPLFQSPEFLDHIRKVMLVIDAAVTNVEDLS-ASLGRKHRAVGVKLSSFSTVGESLLYMLEKCAFTPATRAAWSQLYGAVVQAMSR 146
3 -8.010sp|P69892|HBG2_HUMAN Hemoglobin subunit gamma-2 OS=Homo sapiens GN=HBG2 PE=1 SV=2  ali follow..  13  4..FTEEDKATITSLWGKVNVEDAGGETLGRLLV---VYPWTQRFFDNPKVKAHGKKVLTSLGDALDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHEFTPEVQASWQKMVTGVASALSS 144
4 -7.850sp|Q6B0K9|HBM_HUMAN Hemoglobin subunit mu OS=Homo sapiens GN=HBM PE=2 SV=1  ali follow..  13  1.MLSAQERAQIAQVWDLI--AGHEAQFGAELLLRLFTYPSTKVYFDATQLLSHGQRMLAAVGAAVQHVDNLRASPLADLHLVLRVDPANFPLLIQCFHVVLASHEFTVQMQAAWDKFLTGVAVVLTE 138
5 -7.370sp|P02100|HBE_HUMAN Hemoglobin subunit epsilon OS=Homo sapiens GN=HBE1 PE=1 SV=2  ali follow..  13  4..FTAEEKAAVTSLWSKMNVEEAGGEALGRLLV---VYPWTQRFFDNPKVKAHGKKVLTSFGDAMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHEFTPEVQAAWQKLVSAVAIALAH 144
6 -7.310sp|P02042|HBD_HUMAN Hemoglobin subunit delta OS=Homo sapiens GN=HBD PE=1 SV=2  ali follow..  12  4..LTPEEKTAVNALWGKVNVDAVGGEALGRLLV---VYPWTQRFFESMGNPKVKAHGKKVLGAFLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNEFTPQMQAAYQKVVAGVANALAH 144
7 -6.680sp|Q2PPJ7|RGPA2_HUMAN Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens GN=RALGAPA2 PE=1 SV=2  ali   14  4.ILNTIIRHCPPRFFSL--GFPGFSMLVGDFIT------AAARVLSTDILTAPRSEAVTVLGSLVCFPNTYQEIPLLQSVPEVNEAITGTEDVKHYLINILLKNATEEPNEYARCIAVCSLGVWICE 121
8 -6.410sp|Q6DN90|IQEC1_HUMAN IQ motif and SEC7 domain-containing protein 1 OS=Homo sapiens GN=IQSEC1 PE=1 SV=1  ali   14  15..............IRVQGEAQKVERLIEAFSQRCICNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKL------------EDFIKNLRGVDDGEDIPREMLMGIYERIRK....... 109
9 -6.400sp|P36776|LONM_HUMAN(removed signalp:1-16) Lon protease homolog, mitochondrial OS=Homo sapiens GN=LONP1 PE=1 SV=2  ali   170AALTGAESHELQDVLEETNIPKRLYKALSLLKKEFEL--KLQQRLGREVEEKIKQTHRKY----------LLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLG..... 280
10 -6.270sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo sapiens GN=HBA1 PE=1 SV=2  ali follow..  12  2.VLSPADKTNVKAAWGKV--GAHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKGHGKKVADAMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHEFTPAVHASLDKFLASVSTVLTS 139

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.