current user: public

If you have questions about the server, please let us know.

Query: d2itka2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTELast
1 -75.700sp|Q13526|PIN1_HUMAN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens GN=PIN1 PE=1 SV=1  ali follow..  100  51EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 163
2 -51.800sp|Q9Y237|PIN4_HUMAN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 OS=Homo sapiens GN=PIN4 PE=1 SV=1  ali follow..  35  34GGNAVKVRHILC---------------------EKHGKIMEAMEKLKSG-MRFNEVAAQYSEDKA-RQGGDLGWMTRGSMVGPFQEAAFALPVSGMDPPVKTKFGYHIIMVEG 129
3 -6.380sp|Q13435|SF3B2_HUMAN Splicing factor 3B subunit 2 OS=Homo sapiens GN=SF3B2 PE=1 SV=2  ali   16  75.PDFIKRTGI-----QEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGK-----EFETRLKEKKPGDLSDELRISLGM....... 169
4 -5.850sp|O60844|ZG16_HUMAN(removed signalp:1-18) Zymogen granule membrane protein 16 OS=Homo sapiens GN=ZG16 PE=1 SV=1  ali follow..  14  35............................................RVRVNTYYIVGLQVRYGKVWSDYVGGRNG-----------DLEEIFLHPGESVIQVSGKYKWYLKKLV. 91
5 -5.620sp|Q9BXL6|CAR14_HUMAN Caspase recruitment domain-containing protein 14 OS=Homo sapiens GN=CARD14 PE=1 SV=2  ali   12  5DQMALRPGTQIVMVDYEASEPLFKAVLEDTTLEEAVGLLRRVDGFCKVNTDGYKRLLQDLEA--KVATSGDSFYIRVNLAMEGRAKGELQVHCNEVLHVTDTMFQ........ 111
6 -5.550sp|Q8N3V7|SYNPO_HUMAN Synaptopodin OS=Homo sapiens GN=SYNPO PE=1 SV=2  ali   21  110..........VVKAGQMMTASPSPGPGPRVAQKPALGRSTSLTEKLKEAKARSQQIAAQLTTPPSSNSRGVQLFNRRRQRVNEFTLESHG....................... 190
7 -5.490sp|Q8NE01|CNNM3_HUMAN(removed signalp:1-27) Metal transporter CNNM3 OS=Homo sapiens GN=CNNM3 PE=1 SV=1  ali   11  186....LYLKDLAFVDPEDCTPLSTITRFYNHP--FNDTKLDAVLEEFKRGKSHLAIVQKVNNEGEGDPFYEVLGLVT-------LEDVIEEIIRSEILD............... 274
8 -5.360sp|Q9UKN7|MYO15_HUMAN Myosin-XV OS=Homo sapiens GN=MYO15A PE=1 SV=2  ali   11  111.........IIISGESGSGKTEATKLILRYLAAMNQKREVMQQIKILEATPLLESFAKTVRNDNSSRFGKFVEIFLEGGVISGAITSQYLLEKSRIVFQAKNERNYHIF.... 212
9 -5.230sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=2  ali   20  216..............PPCPSPTIPGPLPTPSRKQEIIKTTEQLIEAVNNG--DFEAYAKICDPGLTSFEPEALGNLVEG----DFHRFYFENLLAKNSKPIHT........... 298
10 -5.230sp|Q6UWF7|FA55D_HUMAN(removed signalp:1-27) Protein FAM55D OS=Homo sapiens GN=FAM55D PE=2 SV=1  ali follow..  19  42...ELRIKEIIEKLDQQIPPRPFTHVNTTTSATHSTATILNPRDTYCRGDQLHILLEVRDHLGRRKQYGGD---FLRARMSSP------ALMAGASGKVTDFNNGTYLVSFT. 141

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.