current user: public

If you have questions about the server, please let us know.

Query: d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}, from SCOP207

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200
# Score Template Links and tools%idFirst MKVEELAESISSYAVGILKEEGIEELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREAIKGGKSLYVVPLRALAGEKYESFKKWEKIGLRIGISTGDYESRDEHLGDCDIIVTTSEKADSLIRNRASWIKAVSCLVVDEIHLLDSEKRGATLEILVTKMRRMNKALRVIGLSATAPNVTEIAEWLDADYYVSDWRLast
1 -76.500sp|Q8TDG4|HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV=2  ali   30  17.......YSLPSKVRDLYAQKGIEKLYEWQHTCLTLVQERKNLIYSLPTSGGKTLVAEILMLQELLCRKDVLMILPYVAIVQEKISGLSSGIELGFFVEEYAGSKGPPTKRREKKSLYIATIEKGHSLVNSETGRIDSLGLVVVDELHMIGEGSRGATLEMTLAKILYTSKTTQIIGMSATLNNVEDLQKFLQAEYYTSQFR 220
2 -69.200sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2  ali   36  15.......EKLPKYAQAGFE--GFKTLNRIQSKLYRAALTDENLLLCAPTGAGKTNVALMCMLREIGKDFKIIYIAPMRSLVQEMVGSFGRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGEYTQLVRLIILDEIHLLHDD-RGPVLEALVARAIRNQEDVRLIGLSATLPNYEDVATFLRVDYFDNSFR 231
3 -68.300sp|Q8N3C0|HELC1_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3  ali   30  8VYIQDLDEIGQLAF------KGMKRLNRIQSIVFETAYTNENMLICAPTGAGKTNIAMLTVLHEIRQEFKIVYVAPMKALAAEMTDYFSRLEPLGIIVKELTGDMQLSKSEILRTQMLVTTPEKWDVVTRKSVGLSQIVRLLILDEVHLLHED-RGPVLESIVARTLRQQSMIRILGLSATLPNYLDVATFLHVNFFDGRFR 227
4 -65.100sp|Q8N3C0|HELC1_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3  ali   35  123.....................NFSHFNPVQTQIFHTLYTDCNVLLGAPTGSGKTVAAELAIFRVFNKTSKAVYIAPLKALVRERMDDWKV-EKLGKKVIELTGDVTPDMKSIAKADLIVTTPEKWDGVSRSWQNYVQQVTILIIDEIHLLGEE-RGPVLEVIVSRTNFIEKPVRIVGLSTALANARDLA............. 300
5 -64.100sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2  ali   28  112.........LRNSAFESLYQDKFPFFNPIQTQVFNTVYSDDNVFVGAPTGSGKTICAEFAILRMLLQEGRCVYITPMEALAEQVYMDWYE-DRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQNVQNINLFVVDEVHLIGGE-NGPVLEVICSRMRYIERPIRIVALSSSLSNAKDV.............. 300
6 -62.500sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=1 SV=2  ali   33  1............................................ICAPTGSGKTVVFELAITRLLMENIKIVYMAPIKALCSQRFDDWEKFGPIGLNCKELTGDTVDDLFEIQHAHIIMTTPEKWDSMTRKWRDLVQLVRLFLIDEVHIVKDENRGPTLEVVVSRMKTVQSPMRFVAVSATIPNAEDIAEWLSDGKMDESHR 187
7 -60.400sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=1 SV=2  ali   27  112KAVTEIPAKFRSIF------KEFPYFNYIQSKAFDDLLTDRNFVICAPTGSGKTVVFELAITRLLMENIKIVYMAPIKALCSQRFDDWEKFGPIGLNCKELTGDTVMDDFEIQHAHIIMTTPEKWDSMTRKWRDLVQLVRLFLIDEVHIVKDENRGPTLEVVVSRMKTVQSVSQTLKNTSTA.................... 298
8 -58.900sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2  ali   30  1...............................................PTGSGKTICAEFAILRMLLQEGRCVYITPMEALAEQVYMDWYE-DRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQNVQNINLFVVDEVHLIGGE-NGPVLEVICSRMRYIERPIRIVALSSSLSNAKDVAHWLGCSNFHPNVR 169
9 -57.700sp|Q8N3C0|HELC1_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3  ali   35  1................................................TGSGKTVAAELAIFRVFNKTSKAVYIAPLKALVRERMDDWKV-EKLGKKVIELTGDVTPDMKSIAKADLIVTTPEKWDGVSRSWQNYVQQVTILIIDEIHLLGEE-RGPVLEVIVSRTNFISSHVRIVGLSTALANARDLADWLNIKNFRPSVR 168
10 -46.500sp|Q5H9U9|DDX6L_HUMAN Probable ATP-dependent RNA helicase DDX60-like OS=Homo sapiens GN=DDX60L PE=2 SV=1  ali   22  1................................LLDVVDKNESAVIVAPTSSGKTYASYYCMEKVLRESGVVVYVAPAKSLVGQVAATVERFTKTLPAGRTPCGAFTRDYRNVLNCQVLITVPECFEILLLHRQKWVERIRYVIFDEVHYLGREVGAKFWELLLVIIR-----CPFLVLSATINNPNLLTKWLQS........ 163
11 -45.800sp|Q5H9U9|DDX6L_HUMAN Probable ATP-dependent RNA helicase DDX60-like OS=Homo sapiens GN=DDX60L PE=2 SV=1  ali   22  143........................IPNAWQQELLDVVDKNESAVIVAPTSSGKTYASYYCMEKVLRESGVVVYVAPAKSLVGQVAATVNRFTKTLPAGRTPCGAFTRDYRNVLNCQVLITVPECFEILLLHRQKWVERIRYVIFDEVHYLGREVGAKFWELLLVIIR-----CPFLVLSAT..................... 300
12 -44.900sp|Q15477|SKIV2_HUMAN Helicase SKI2W OS=Homo sapiens GN=SKIV2L PE=1 SV=3  ali   25  10........................EPDVFQKQAILHLERHDSVFVAAHTSAGKTVVAEYAIALAQKHMTRTIYTSPIKALSNQKFRDFNTFGDVGL----LTGDVQLH----PEASCLIMTTEILRSMLYSGSDVIRDLEWVIFDEVHYINDVERGVVWEEVLIML---PDHVSIILLSATVPNALEFADWIGIYVISTVTR 183
13 -43.200sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=2 SV=3  ali   23  13........................IPDTWQRELLDVVDKNESAVIVAPTSSGKTYASYYCMEKVLKESGVVVYVAPTKALVNQVAATVKNLPSGEVLCGVFTREYRHDA---LNCQVLITVPACFEILLLHRQNWVKKIRYVIFDEVHCLGGEIGAEIWEHLLVMI-----RCPFLALSATISNPEHLTEWLQS........ 183
14 -43.200sp|P42285|SK2L2_HUMAN Superkiller viralicidic activity 2-like 2 OS=Homo sapiens GN=SKIV2L2 PE=1 SV=3  ali   26  1....................................VDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMEEFQDVGL----MTGDVTIN----PTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILL---PDNVHYVFLSATIPNARQFAEWICCHVIYTDYR 162
15 -42.200sp|Q8N3C0|HELC1_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3  ali   29  172....................KGMKRLNRIQSIVFETAYTNENMLICAPTGAGKTNIAMLTVLHEIRQEFKIVYVAPMKALAAEMTDYFRRLEPLGIIVKELTGDMQLSKSEILRTQMLVTTPEKWDVVTRKSVGDVA................................................................. 300
16 -42.100sp|P42285|SK2L2_HUMAN Superkiller viralicidic activity 2-like 2 OS=Homo sapiens GN=SKIV2L2 PE=1 SV=3  ali   28  139........................ILDAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEFQDVGL----MTGDVTIN----PTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILL---PDNVHYVFLSATIPNARQFAEWIC......... 297
17 -41.900sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=2 SV=3  ali   22  163........................IPDTWQRELLDVVDKNESAVIVAPTSSGKTYASYYCMEKVLKESGVVVYVAPTKALVNQVAATVNRFTKNLPSGEVLCGVFTREYRDALNCQVLITVPACFEILLLARQNWVKKIRYVIFDEVHCLGGE-IGA............................................. 300
18 -41.000sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2  ali   34  162LPVEKLPKYAQAGF------EGFKTLNRIQSKLYRAALTDENLLLCAPTGAGKTNVALMCMLREIGKDFKIIYIAPMRSLVQEMVGSFKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKG...................................................................... 300
19 -39.600sp|Q8TDG4|HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV=2  ali   25  167.......YSLPSKVRDLYAQKGIEKLYEWQHTCLTSVQERKNLIYSLPTSGGKTLVAEILMLQELLCRKDVLMILPYVAIVQEKISGLSSGIELGFFVEEYAGSKGPPTKRREKKSLYIATIEKGHSLVNSLIE.................................................................... 300
20 -35.200sp|Q15477|SKIV2_HUMAN Helicase SKI2W OS=Homo sapiens GN=SKIV2L PE=1 SV=3  ali   24  160........................EPDVFQKQAILHLERHDSVFVAAHTSAGKTVVAEYAIALAQKHMTRTIYTSPIKALSNQKFRDFRTFGDVGL----LTGDVQLH----PEASCLIMTTEILRSMLYSGSDVIRDLEWVIFDEVHYINDVERGVVWEEVLIML.................................... 294
21 -33.900sp|Q8TDG4|HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV=2  ali   38  1....................................................................................................................................TGRIDSLGLVVVDELHMIGEGSRGATLEMTLAKILYTSKTTQIIGMSATLNNVEDLQKFLQAEYYTSQFR 70
22 -32.600sp|Q96C10|DHX58_HUMAN Probable ATP-dependent RNA helicase DHX58 OS=Homo sapiens GN=DHX58 PE=1 SV=1  ali   25  2........................ELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLEDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDMGPRGHLARCHDLLICTAELLQMALTSPEEELTVFSLIVVDECHHTHKDTVYNVIQYLELKLQRAQPLPQVLGLTASINHVLQLCANLDTWCIMS... 199
23 -31.500sp|Q8IYB8|SUV3_HUMAN(removed signalp:1-18) ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens GN=SUPV3L1 PE=1 SV=1  ali   18  19..........................IPPNWYPDARAMQRKIIFHSGPTNSGKTYHA----IQKYFSAKSGVYCGPLKLLAHEI---FEKSNAAGVPCDLVTGEERVTVQP-KQASHVSCTVEMCSV--------TTPYEVAVIDEIQMIRDPARGWAWTRALLGLC---AEEVHLCGEPAAIDLVMELMYTTGEEV..... 172
24 -30.700sp|O95786|DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 OS=Homo sapiens GN=DDX58 PE=1 SV=2  ali   18  95...........................NYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKQKGKVVFFANQIPVYEQQKSVFSKYFERHGRVTGISGATAENEQIVENNDIIILTPQ-VNNLKKGTIPSLSIFTLMIFDECHTSKQHPYNMIMFNYLDQKLGGSSG-QVIGLTASLDYICKLCASLDASVIAT... 291
25 -30.600sp|Q9UPY3|DICER_HUMAN Endoribonuclease Dicer OS=Homo sapiens GN=DICER1 PE=1 SV=3  ali   16  46...........................KYQVELLEAALD-HNTIVCLNTGSGKTFIAVLLTKELSYQGKRTVFLVNSANQVAQQVSAVRTH--SDLKVGEYSNLEVNANQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECH---LAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKI...... 223
26 -30.300sp|Q9UHI6|DDX20_HUMAN Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens GN=DDX20 PE=1 SV=2  ali   19  68........LLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLNLSTQILILAPTREIAVQIHSVITAIGI-GLECHVFIGPLSQDKTRLKKCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKL---EEGSFQEQINWIYSSLPASKQMLAVSATYPE.................. 248
27 -30.200sp|Q9BYX4|IFIH1_HUMAN Interferon-induced helicase C domain-containing protein 1 OS=Homo sapiens GN=IFIH1 PE=1 SV=3  ali   23  7........................QLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKPGKVIVLVNKVLLVEQLFRKEFQFLKKWYRVIGLSGDTQLKPEVVKSCDIIISTAQILENSLLNLENQLSDFSLIIIDECHHTNKEAVYNNINRLKKENKPVIPLPQILGLTASEEHILKLCANLDAFTIKT... 220
28 -29.600sp|Q8IYD8|FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens GN=FANCM PE=1 SV=2  ali   20  93...........................DYQLHISRAALF-CNTLVCLPTGLGKTFIAAVVMYNFYRPSGKVVFMAPTKPLVTQQIEACYQVMGIPQHMAEMTGSTQASKEIWCSKRVLFLTPQVMVNDLSRGACPAAEIKCLVIDEAH---KALGNYAYCQVVRELVKYTNHFRILALSATPGSDIK............... 253
29 -28.200sp|Q9BYX4|IFIH1_HUMAN Interferon-induced helicase C domain-containing protein 1 OS=Homo sapiens GN=IFIH1 PE=1 SV=3  ali   27  157........................QLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKPGKVIVLVNKVLLVEQLFRKFQPFLKKWYRVIGLSGDTQLKPEVVKSCDIIISTAQILENSLLNLENQLSDFSLIIIDECH...................................................... 296
30 -27.300sp|Q8N8A6|DDX51_HUMAN ATP-dependent RNA helicase DDX51 OS=Homo sapiens GN=DDX51 PE=1 SV=3  ali   22  54........DVHPDLQKQLRAHGISSYFPVQAAVIPALLESSDLCVSAPTGSGKTLAFVIPVVQALLSRVRALVVLPTKELAQQVSKVFNIYTDTPLRVSLVTGQKSLAKEQ-CLADIVVATPGRLDHIDQTPGFSLQQLRFLIIDEADRMIDSMHQSWLPRVVAAAFQSEDPLQKLLFSATLTNPEKLQQ............ 293
31 -26.100sp|Q9NVP1|DDX18_HUMAN ATP-dependent RNA helicase DDX18 OS=Homo sapiens GN=DDX18 PE=1 SV=2  ali   22  28.SFASLCNLVNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLRGVLILSPTRELAMQTFGVLKELMTHVHTYGLIMGGSNRSAEA-NGINIIVATPGRLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLL---PTRRQTMLFSATQTKVEDLAR............ 226
32 -25.900sp|Q86TM3|DDX53_HUMAN Probable ATP-dependent RNA helicase DDX53 OS=Homo sapiens GN=DDX53 PE=1 SV=3  ali   21  78........QQYPDLLKSIIRVGIVKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPIMLVLTPTRELALHVEAECSKYSYKGLKSICIYGGRNRNGQ--KGVDIIIATPGRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVR---PDRQTVMTSATWPTVRQLAL............ 269
33 -25.900sp|Q9BQ39|DDX50_HUMAN ATP-dependent RNA helicase DDX50 OS=Homo sapiens GN=DDX50 PE=1 SV=1  ali   22  1................LLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGKTFSFAIPLIERLQRNQKVLVLAPTRELANQVAKDFKDITR-KLSVACFYGGTSYQSQ--NGIDILVGTPGRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESTDSEDNPQTLLFSATCPQ.................. 181
34 -25.900sp|Q9NR30|DDX21_HUMAN Nucleolar RNA helicase 2 OS=Homo sapiens GN=DDX21 PE=1 SV=5  ali   23  42........PISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLHGELQVLVLAPTRELANQVSKDFSDITK-KLSVACFYGGTPYGGQ--NGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAKDSEDNPQTLLFSATCPH.................. 230
35 -25.700sp|Q9NXZ2|DDX43_HUMAN Probable ATP-dependent RNA helicase DDX43 OS=Homo sapiens GN=DDX43 PE=1 SV=2  ali   22  98........QCYPEVMENIKKAGFQKPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLCYLMPGFIHLVLQPSMLVLTPTRELALQVEGECCKYSYKGLRSVCVYGGGNRDEQ--KGVDIIIATPGRLNDLQMSNFVNLKNITYLVLDEADKMLDMGFEPQIMKILLDVR---PDRQTVMTSATWPSVHRLAQ............ 289
36 -25.600sp|O94761|RECQ4_HUMAN ATP-dependent DNA helicase Q4 OS=Homo sapiens GN=RECQL4 PE=1 SV=1  ali   21  16..........PAEVFQALEQLGHQAFRPGQERAVMRILSGISTLLVLPTGAGKSLCYQLALLYSRRSPCLTLVVSPLLSLMDDQVSGLPP----CLKAACIHSGMTRKQRE-AQVHVLMLTPEALVG-GLPPAAQLPPVAFACIDEAHCLSQWSHNPCYLRVCKVLRERMGVHCFLGLTATATRASDVAQHLAVA....... 209
37 -25.600sp|Q8IYB8|SUV3_HUMAN(removed signalp:1-18) ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens GN=SUPV3L1 PE=1 SV=1  ali   22  169..........................IPPNWYPDARAMQRKIIFHSGPTNSGKTYHA----IQKYFSAKSGVYCGPLKLLAHEI---FEKSNAAGVPCDLVTGEERVVQPNGKQASHVSCTVEMCSV--------TTPYEVAVIDEIQMIRDPARGWAWTRALLGLC................................... 295
38 -25.500sp|Q13206|DDX10_HUMAN Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens GN=DDX10 PE=1 SV=2  ali   21  75........PLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFLVPVLEALYRLQGVLIISPTRELAYQTFEVLRKVGKHDFSAGLIIGDLKHEAERINNINILVCTPGRLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENL---PKKRQTLLFSATQTSVKDLAR............ 265
39 -25.300sp|Q9GZR7|DDX24_HUMAN ATP-dependent RNA helicase DDX24 OS=Homo sapiens GN=DDX24 PE=1 SV=1  ali   19  25........VSDQALLFGDDDAGEGPSSLIREKPVPKQNENEENLDKEQTGNLKQELDDKSATCKAYPKRLGLVLTPTRELAVQVKQHIDAVARTGIKTAILVGGMSTQKQQ-RRPEIVVATPGRLWELIKEKHRNLRQLRCLVVDEADRMVEKGHFAELSQLLEMLSQYNPKRQTLVFSATLT................... 211
40 -25.100sp|O15523|DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo sapiens GN=DDX3Y PE=1 SV=2  ali   18  34........DMGEIIMGNIELTRYTRPTPVQKHAIPIIKGKRDLMACAQTGSGKTAAFLLPILSQIYTDGPSLVLAPTRELAVQIYEEARKFSRSRVRPCVVYGGADIGQQI-RGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDMPPKGVRHTMMFSATFPEIQMLAR............ 242
41 -25.000sp|Q5T1V6|DDX59_HUMAN Probable ATP-dependent RNA helicase DDX59 OS=Homo sapiens GN=DDX59 PE=1 SV=1  ali   19  59........SLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMRALFESKALILTPTRELAIQIERQAKELMS-RMKTVLLVGGLPLPPQL-QHVKVIIATPGRLLDIIKQSSVELCGVKIVVVDEADTMLKMGFQQQVLDILENIP---NDCQTILVSATIPSIEQLAS............ 246
42 -25.000sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens GN=DDX27 PE=1 SV=2  ali   16  74........NLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFALPVLERLIYKPRVLVLVPTRELGIQVHSVTRQLAQCNITTCLAVGGLDVKSQE-AAPDILIATPGRLDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMC---SHHRQTMLFSATMTD.................. 257
43 -24.900sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3  ali   18  36........EMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPSLVLAPTRELAVQIYEEARKFSRSRVRPCVVYGGADIGQQI-RGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTM-KGVRHTMMFSATFPEIQMLAR............ 244
44 -24.900sp|Q8TDD1|DDX54_HUMAN ATP-dependent RNA helicase DDX54 OS=Homo sapiens GN=DDX54 PE=1 SV=2  ali   20  102........GLSYPVFKGIMKKGYKVPTPIQRKTIPVILDGKDVVAMARTGSGKTACFLLPMFERLKTHSRALILSPTRELALQTLKFTKELGKTGLKTALILGGDRMEDQF-ENPDIIIATPGRLVHVAVEMSLKLQSVEYVVFDEADRLFEMGFAEQLQEIIARLP---GGHQTVLFSATLPK.................. 283
45 -24.800sp|Q9H8H2|DDX31_HUMAN Probable ATP-dependent RNA helicase DDX31 OS=Homo sapiens GN=DDX31 PE=1 SV=2  ali   20  89..........PHLISTINTVLKMSSMTSVQKQSIPVLLEGRDALVRSQTGSGKTLAYCIPVVQSLQDGPYALVLVPTRELALQSFDTVQKLLK-WIVPGVLMGGEKRKSEK-KGINILISTPGRLDHIKSTKNIHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTGVTRLAD............ 284
46 -24.600sp|Q86XP3|DDX42_HUMAN ATP-dependent RNA helicase DDX42 OS=Homo sapiens GN=DDX42 PE=1 SV=1  ali   18  109........GFDEQLMHQIRKSEYTQPTPIQCQGVPVALSGRDMIGIAKTGSGKTAAFIWPMLIHIMDQKEAVIVCPTRELCQQIHAECKRFGKYNLRSVAVYGGGSMWEQ--EGAEIVVCTPGRLIDHVKKKATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVR---PDRQTLLFSATFRKIEKLAR............ 300
47 -24.500sp|Q9NQI0|DDX4_HUMAN Probable ATP-dependent RNA helicase DDX4 OS=Homo sapiens GN=DDX4 PE=2 SV=2  ali   20  1...............NNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHMMHDGECIIVAPTRELVNQIYLEARKFSGTCVRAVVIYGGTQLGHSI-QGCNILCATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDMGFGPEMKKLISCPGMSKEQRQTLMFSATFPEIQRLAA............ 193
48 -24.500sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2  ali   18  37........KFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKGLIICPSRELARQTHGILEYYCRLLLRCALCIGGMSVKEQM-HGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFK---GQRQTLLFSATMPKIQNFAK............ 237
49 -24.400sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2  ali   39  2...................................................................................................................................ERTYTQLVRLIILDEIHLLHDD-RGPVLEALVARAIRNQEDVRLIGLSATLPNYEDVATFLRVDYFDNSFR 81
50 -24.100sp|Q8N3C0|HELC1_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3  ali   35  2.......................................................................................................................................SQIVRLLILDEVHLLHED-RGPVLESIVARTLRQQSMIRILGLSATLPNYLDVATFLHVNFFDGRFR 77
51 -24.000sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1  ali   17  100........NFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFCLVLAPTRELAQQVQQVAAEYCRCRLKSTCIYGGAPKGPQ--RGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIR---PDRQTLMWSATWPEVRQLAE............ 291
52 -23.900sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=1  ali   19  98........NFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYCLVLAPTRELAQQVQQVADDYGKSRLKSTCIYGGAPKGPQ--RGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIR---PDRQTLMWSATWPEVRQLAE............ 289
53 -23.800sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens GN=EIF4A3 PE=1 SV=4  ali follow..  16  44........GLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLVRETQALILAPTRELAVQIQKGLLALGDMNVQCHACIGGTNVGED--YGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYL---PPATQVVLISATLPH.................. 223
54 -23.600sp|P60842|IF4A1_HUMAN Eukaryotic initiation factor 4A-I OS=Homo sapiens GN=EIF4A1 PE=1 SV=1  ali follow..  21  38........NLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQILKATQALVLAPTRELAQQIQKVVMALGDMGASCHACIGGTNVRAEQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKL---NSNTQVVLLSATMPS.................. 218
55 -23.500sp|Q14240|IF4A2_HUMAN Eukaryotic initiation factor 4A-II OS=Homo sapiens GN=EIF4A2 PE=1 SV=2  ali follow..  19  39........NLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLFKETQALVLAPTRELAQQIQKVILALGDMGATCHACIGGTNVRNEQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKL---NTSIQVVLLSATMPT.................. 219
56 -23.400sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3  ali   18  97........SLPPHILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKAIILAPTRELAQQIEEETIKFGKLGIRTVAVIGGISREDQGFMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMP--VSNQKPDTDEAEDPE.................. 286
57 -23.400sp|Q7L014|DDX46_HUMAN Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens GN=DDX46 PE=1 SV=2  ali   24  78........GISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSAVIMTPTRELALQITKECKKFSKLGLRVVCVYGGTGISEQ--RGAEIIVCTPGRMIDMLAANSGRLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVR---PDRQTVMFSATFPAMEALAR............ 272
58 -23.300sp|Q9Y6V7|DDX49_HUMAN Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens GN=DDX49 PE=1 SV=1  ali follow..  22  8........GLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPILQKLSEDPYCLVLTPTRELAYQIAEQFRVLGKLGLKDCIIVGGMDMVAQALRKPHVVIATPGRLDHLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTD.................. 191
59 -23.200sp|Q9UMR2|DD19B_HUMAN ATP-dependent RNA helicase DDX19B OS=Homo sapiens GN=DDX19B PE=1 SV=1  ali follow..  15  98........RLKPQLLQGVYAMGFNRPSKIQENALPLMLAEQNLIAQSQSGTGKTAAFVLAMLSQVNKYPQCLCLSPTYELALQTGKVIEQMGKFELKLAYAVRGNKLERGQKISEQIVIGTPGTLDWCSKLKFIDPKKIKVFVLDEADVM---ATQGHQDQSIRIQRMLPRNCQMLLFSATFED.................. 279
60 -23.200sp|Q9NY93|DDX56_HUMAN Probable ATP-dependent RNA helicase DDX56 OS=Homo sapiens GN=DDX56 PE=1 SV=1  ali follow..  20  13........GLDPRLLQAVTDLGWSRPTLIQEKAIPLALEGKDLLARARTGSGKTAAYAIPMLQLLLHRKRGLVLVPTKELARQAQSMIQQLATYDVRVANVSAAEDSVSQR-EKPDVVVGTPSRISHLQQDSLKLRDSLELLVVDEADLLFSFGFEEELKSLLCHL---PRIYQAFLMSATFNE.................. 202
61 -23.200sp|Q9UHL0|DDX25_HUMAN ATP-dependent RNA helicase DDX25 OS=Homo sapiens GN=DDX25 PE=1 SV=2  ali follow..  14  103........RLKEELLKGIYAMGFNRPSKIQEMALPMMLAHQNLIAQSQSGTGKTAAFVLAMLSRVELFPQCLCLAPTYELALQTGRVVEQMGKFDVQVMYAIRGNRIPRGTDITKQIIIGTPGTLDWCFKLKLIDLTKIRVFVLDEADVM---DTQGFSDHSIRIQRALPSECQMLLFSATFED.................. 284
62 -23.100sp|Q9NUU7|DD19A_HUMAN ATP-dependent RNA helicase DDX19A OS=Homo sapiens GN=DDX19A PE=1 SV=1  ali follow..  15  97........RLKPQLLQGVYAMGFNRPSKIQENALPMMLAEQNLIAQSQSGTGKTAAFVLAMLSRVDRYPQCLCLSPTYELALQTGKVIEQMGKFELKLAYAVRGNKLERGQKISEQIVIGTPGTLDWCSKLKFIDPKKIKVFVLDEADVM---ATQGHQDQSIRIQRMLPRNCQMLLFSATFED.................. 278
63 -22.900sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1  ali follow..  19  30........GVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQALVLTPTRELAFQISEQFEALGSIGVQSAVIVGGIDSMSQSLKKPHIIIATPGRLDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVI---PRDRKTFLFSATMTK.................. 210
64 -22.800sp|O00148|DDX39_HUMAN ATP-dependent RNA helicase DDX39 OS=Homo sapiens GN=DDX39 PE=1 SV=2  ali follow..  17  50........LLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQINGQVTVLVMCHTRELAFQISKEYERFSKYSVKVSVFFGGLSIKKDKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECKMLEQLDMRRDVQEIFRLT---PHEKQCMMFSATLSK.................. 232
65 -22.800sp|Q13838|UAP56_HUMAN Spliceosome RNA helicase BAT1 OS=Homo sapiens GN=BAT1 PE=1 SV=1  ali follow..  17  51........LLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLTGQVSVLVMCHTRELAFQISKEYERFSKYNVKVAVFFGGLSIKKDKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECKMLEQLDMRRDVQEIFRMT---PHEKQVMMFSATLSK.................. 233
66 -22.800sp|P19447|ERCC3_HUMAN TFIIH basal transcription factor complex helicase XPB subunit OS=Homo sapiens GN=ERCC3 PE=1 SV=1  ali   18  15........................VLRPYQEKSLRKMFGNGR-VIVLPCGAGKSLVGVTAACTV---RKRCLVLGNSAVSVEQWKAQFKMWSTID-QICRFTSD---AKDKPIGCSVAISTYSMLGHTTKRSWEAERVMGLMILDEVHTIPAKMFRRVLTIVQAHCK--------LGLTATLVREDDKIVDL.......... 180
67 -22.600sp|Q9NUL7|DDX28_HUMAN(removed signalp:1-25) Probable ATP-dependent RNA helicase DDX28 OS=Homo sapiens GN=DDX28 PE=2 SV=2  ali follow..  22  107........GLEPRVLHALQEAAPEVVQPVQSSTIPSLLRGRHVVCAAETGSGKTLSYLLPLLQRLLGQPRGLVLVPSRELAQQVRAVAQPLGRLGLLVRDLEGGHGMRRIRLQSADVLVATPGALWKALKSRLISLEQLSFLVLDEADTLLDESFLELVDYILEKSHIFNPKAQLVLVGATFPE.................. 310
68 -22.600sp|P26196|DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens GN=DDX6 PE=1 SV=2  ali follow..  21  102........CLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLKDNIQAMVIVPTRELALQVSQICIQVSK-GAKVMATTGGTNLRDD--DTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTL---PKNRQILLYSATFPL.................. 282
69 -21.800sp|P46063|RECQ1_HUMAN ATP-dependent DNA helicase Q1 OS=Homo sapiens GN=RECQL PE=1 SV=3  ali   22  88.....................KLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQL----ALCSDGFTLVICPLISLMEDQLMVLKQ---LGISATMLNASSSKEHVK-SELKLIYVTPEKIAKSKMEKAYEARRFTRIAVDEVHCCSQWGHDFRPDY-LGILKRQFPNASLIGLTATATNLTDAQKILCIE....... 272
70 -21.700sp|Q9BQ39|DDX50_HUMAN ATP-dependent RNA helicase DDX50 OS=Homo sapiens GN=DDX50 PE=1 SV=1  ali   23  143........PISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGKTFSFAIPLIERLQRNQKVLVLAPTRELANQVAKDFKDITR-KLSVACFYGGTSYQSQ--NGIDILVGTPGRIKDHLQSGRLDLSKLRHVVLDEVDQMLD.................................................. 297
71 -21.400sp|Q9NQI0|DDX4_HUMAN Probable ATP-dependent RNA helicase DDX4 OS=Homo sapiens GN=DDX4 PE=2 SV=2  ali   20  144........NLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHMMHDGICIIVAPTRELVNQIYLEARKFSGTCVRAVVIYGGTQLGHSI-QGCNILCATPGRLMDIIGKEKIGLKQIKYLVLDEA....................................................... 298
72 -21.400sp|Q14191|WRN_HUMAN Werner syndrome ATP-dependent helicase OS=Homo sapiens GN=WRN PE=1 SV=1  ali   18  95.....................GHSSFKPVQWKVIHSVLEERDNVAVMATGYGKSLCFQY----PVYVGKIGLVISPLISLMEDQVLQLKMSNIPACFLGSAQSENVLTDIKLGKYRIVYVTPEYCSGNMGLLQQLEADITLIAVDEAHCISEWGHDFRDSFRLGSLKTALPMVPIVALTATASSREDIVRCLNLR....... 271
73 -21.400sp|P54132|BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1  ali   20  64.....................GLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQL----ACVSPGVTVVISPLRSLIVDQVQKLTS---LDIPATYLTGDKTDSEAT-PIIKLLYVTPEKICASNRENLYERKLLARFVIDEAHCVSQWGHDFRQDY-MNMLRQKFPSVPVMALTATANPQKDILTQLKIL....... 248
74 -20.700sp|Q8NHQ9|DDX55_HUMAN ATP-dependent RNA helicase DDX55 OS=Homo sapiens GN=DDX55 PE=1 SV=3  ali follow..  20  8.SWESLPVPLHPQVLGALRELGFPYMTPVQSATIPLFMRNKDVAAEAVTGSGKTLAFVIPILEILLRREGAIIITPTRELAIQIDEVLSHFTK-EFSQILWIGGRNPGEDV-QGGNIIVATPGRLEDMFRRKAEGLDSLDVLVLDEADRLLDMGFEASINTILEFL---PKQRRTGLFSATQTQVENLVR............ 214
75 -20.700sp|Q9Y2R4|DDX52_HUMAN Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens GN=DDX52 PE=1 SV=3  ali follow..  25  171........KINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKKGFRALIISPTRELASQIHRELIKISETGFRIHMIHKAAVAAKK--KKFDILVTTPNRLIYLLKQDPPGLASVEWLVVDESKLFEDGKTGFRDQLASIFLACTSHKVRRAMFSATFADVEQWCK............ 365

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.