current user: public

If you have questions about the server, please let us know.

Query: d3ci3a1 a.25.2.0 (A:2-188) automated matches {Lactobacillus reuteri [TaxId: 1598]}, from SCOP207

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst KIYTKNGDKGQTRIIGKQILYKNDPRVAAYGEVDELNSWVGYTKSLINSHTQVLSNELEEIQQLLFDCGHDLATPADDERHSFKFKQEQPTVWLEEKIDNYTQVVPAVKKFILPGGTQLASALHVARTITRRAERQIVQLMREEQINQDVLIFINRLSDYFFAAARYANYLEQQPDMLYRNSKDVFRLast
1 -85.100sp|Q96EY8|MMAB_HUMAN Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial OS=Homo sapiens GN=MMAB PE=1 SV=1  ali follow..  37  57KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAE 246
2 -8.580sp|Q9P2G9|KLHL8_HUMAN Kelch-like protein 8 OS=Homo sapiens GN=KLHL8 PE=2 SV=4  ali   10  11HVYAVGGNDGMASLSSVERYDPHLDKWIEVKEMGQRRAGNGVSK----------------LHGCLYVVGGFDDNSPLSSVERYDPRSNKWDYVAALTTPRGGVGIATVMGKIFAGGHNGNAYLNTVEAFDPVLNRWELVGSVSHCRAGAGVAVCSCLTSQIRDVG...................... 160
3 -8.240sp|O95140|MFN2_HUMAN Mitofusin-2 OS=Homo sapiens GN=MFN2 PE=1 SV=3  ali   11  90.................EVLARRHMKVAFFGRTSNINAMLW--DKVLPSGIGHTTNCFLRVEGFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSK-LKDDLVPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSENIFILNNRWDASASEPEYMEEVRRQHME 279
4 -7.800sp|Q8IWA4|MFN1_HUMAN Mitofusin-1 OS=Homo sapiens GN=MFN1 PE=1 SV=2  ali   10  69.................EVLSRRHMKVAFFGRTSSINAMLW--DKVLPSGIGHITNCFLSVEGYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVRVFWPKAK-LRDDLVPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNENIFILNNRWDASASEPEYMEDVRRQHME 258
5 -7.210sp|Q494V2|CCD37_HUMAN Coiled-coil domain-containing protein 37 OS=Homo sapiens GN=CCDC37 PE=1 SV=1  ali   11  144.................................................EPENMSGYIKQ-KRQMFLLQYALDVKRREIQRLETLATKEE-ARLERAEKSLEKDAALFDEFVRENDCSSVQAMRAAEKETKAKIEKILEIRDLTTQIVNIKSEISRFEDTLKHYKVYKDFLYKLSPKEWLEEQEKKH 279
6 -7.170sp|Q9P265|DIP2B_HUMAN Disco-interacting protein 2 homolog B OS=Homo sapiens GN=DIP2B PE=1 SV=3  ali   10  80TLWARTGYLG---VRRTEATGERHDALYVVGALDETLELRGLIETSVSRIHRSIAECAVFTWTNLLVVVVELCGSEQEA--------LDLVPLVTNVVLEEHYLIVGVVVVVDPGVIPINSRGEKQRMHLRDS...................................................... 211
7 -7.020sp|Q14689|DIP2A_HUMAN Disco-interacting protein 2 homolog A OS=Homo sapiens GN=DIP2A PE=1 SV=2  ali   12  35RPFTRTGLLGFI---------GPDNLVFIVGKLDGLMVTGVR-----RHNADDVVATALAVEPMKFVYRGRIAVFSVTVLHDDRIVLVAEQRRVLQAIDSIHQVGVYCLALVPANTLPKAPLGGIHISETKQR...................................................... 166
8 -6.990sp|Q9P265|DIP2B_HUMAN Disco-interacting protein 2 homolog B OS=Homo sapiens GN=DIP2B PE=1 SV=3  ali   11  39VPFIRSGLLGFV---------GPGSLVFVVGKMDGLLMVSGR-----RHNADDIVATGLAVESIVFSVDERIVVVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHISQTKQL...................................................... 170
9 -6.860sp|Q9Y2E4|DIP2C_HUMAN Disco-interacting protein 2 homolog C OS=Homo sapiens GN=DIP2C PE=2 SV=2  ali   10  62..WARTGYLG---LRRTELTGERHDALYVVGALDEAMELRGMIETSVIRAHKSVTECAVFTWTNLLVVVVELDGSEQEA--------LDLVPLVTNVVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDG...................................................... 191
10 -6.800sp|Q9BYB0|SHAN3_HUMAN SH3 and multiple ankyrin repeat domains protein 3 OS=Homo sapiens GN=SHANK3 PE=1 SV=2  ali   12  5.......DSGVEEA---DTRSSSDPHLETTSTI----STVSSMSTLSSESGELTDTHTSFADGHTFLLEKPPVPPKPKLKSPLGKGPVTFRDPLLKQSSDSELMAQQHHA---SAGLASAAGPARPRYLFQRRSKDPVESRGLPGPEDDKPTVISELSSRLQQLNK..................... 157

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.