current user: public

If you have questions about the server, please let us know.

Query: d3ldqb1 a.7.7.1 (B:151-260) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst NSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQLast
1 -32.300sp|Q99933|BAG1_HUMAN BAG family molecular chaperone regulator 1 OS=Homo sapiens GN=BAG1 PE=1 SV=4  ali follow..  100  223.SPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ 331
2 -23.700sp|Q9UL15|BAG5_HUMAN BAG family molecular chaperone regulator 5 OS=Homo sapiens GN=BAG5 PE=1 SV=1  ali follow..  17  2DMGNQHPSISRLQEIQKEVKSVEQQVIGF-------------------SGLSDDKNYKKLERILTKQLFEIDSVDTEGK-GDIQQARKRAAQETERLLKELEQNANHPHR 91
3 -15.900sp|O95817|BAG3_HUMAN BAG family molecular chaperone regulator 3 OS=Homo sapiens GN=BAG3 PE=1 SV=3  ali follow..  20  414EAPPKHPGVLKVEAILEKVQGLEQAVDNF-------------------EGKKTDKKYLMIEEYLTKELLALDSVDPEGR-ADVRQARRDGVRKVQTILEKLEQ....... 496
4 -14.300sp|O95429|BAG4_HUMAN BAG family molecular chaperone regulator 4 OS=Homo sapiens GN=BAG4 PE=1 SV=1  ali follow..  25  372SDESTPPSIKKIIHVLEKVQYLEQEVEEF-------------------VGKKTDKAYWLLEEMLTKELLELDSVETGGQ-DSVRQARKEAVCKIQAILEKLEK....... 454
5 -7.920sp|Q8TBA6|GOGA5_HUMAN Golgin subfamily A member 5 OS=Homo sapiens GN=GOLGA5 PE=1 SV=3  ali   14  97............EDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLER....................... 171
6 -7.340sp|Q9Y6C2|EMIL1_HUMAN(removed signalp:1-23) EMILIN-1 OS=Homo sapiens GN=EMILIN1 PE=1 SV=2  ali   13  7.SVFGGSSGSALQALQGELSEVILSFSSLNDSLNELQTTVEGQGADLADLGATKDRIISEINRLQQEA-RFRGLEEGQAQAGQCPSLEGRLGRLEGVCERLDTVAGGLQG 123
7 -7.190sp|Q76M96|CCD80_HUMAN(removed signalp:1-21) Coiled-coil domain-containing protein 80 OS=Homo sapiens GN=CCDC80 PE=1 SV=1  ali   11  71.........................................REDVPAHLVKDIRNYFQVSPEYFSMLLVGKDG--------NVKSWYPSPMWSMVIVYDLIDSMQLRRQE 131
8 -6.860sp|P54132|BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1  ali   19  3..PSPEEIISASSSSSKCLSTLKDLVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHIDTIDCGNELLQQRNIRRKLLTE................. 113
9 -6.780sp|O14777|NDC80_HUMAN Kinetochore protein NDC80 homolog OS=Homo sapiens GN=NDC80 PE=1 SV=1  ali   12  176.........QKLNGLNEEIARVELECETIKQENTRLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELKYARG--KEAIETQLAEYHKLARKLK. 273
10 -6.640sp|Q8IY18|SMC5_HUMAN Structural maintenance of chromosomes protein 5 OS=Homo sapiens GN=SMC5 PE=1 SV=2  ali   198DLEQRRHLEEQLKEIHRKLQAVDSGLIALRETSKHLEHKDNELRQKKKELLERKTKKRQLEQKISSKLGSLKLME--QDTCNLEEEERKASTKIKEINVQ.......... 295

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35