current user: public

If you have questions about the server, please let us know.

Query: d1dlwa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]}, from SCOP207

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGRNLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVTVLast
1 -4.020PB027498 Q7MTK6_PORGI/1-146 PB027498; Pfam-B_27498;  ali follow..  10  73...............................YYDDEELDRYAGV----------LPEEYNTEAVEEFEEILTLQEEEVPSWIRSLQ--MRQIQMPISIKEQALFIVSEHRIQ.... 142
2 -3.240HGC00267 gi|163310129|dbj|BABD01000566.1|6.0 TMP00066;  ali follow..  12  36DLQQAVGGDIEMTYPFDDEVGILLNGN----KFEGLPLNRALYDDHGQVYDAIAGTFLVVGLTEDDF---TSLTPEQIEKFKEKYQSP............................ 117
3 -2.610HGC01024 gi|162869036|dbj|BABB01000971.1|4.0 TMP01399;  ali follow..  30..............IQPDRMENILYDYHLSISMGNNLSYSDNYQKEAYKNYVF---------------EKHHITEAEFDSSMVWYTRHTEEL---ASLYKKLGERFRSEKKHM... 110
4 -2.580PB034180 _Gut.Meta.Jp.0112129_ gi|163310377|dbj|BABD01000320.1||2 (+ 509:1679~0 complete)  ali follow..  12  17...................................................................YTAVQPSDSYFVNLSNKLYGACTLTTLPDIFRKKLGMYIAAYLEDQIS. 64
5 -2.440HGC00150 gi|162733542|dbj|BAAZ01030454.1|1.0 TMP01074;  ali follow..  15..IDELG-----AQAARNLYAGKANAQVVNYLLESPRFLDLTYILEQYFNDTVAAGYAAQNQLYTTISS---TRKTVKTEAGEQAARDIAHLRTSVYIENQFMLAVKEVKKEIGN. 128
6 -2.260HGC00857 gi|162620543|dbj|BAAW01002606.1|2.0 TMP01139;  ali follow..  10  1..MLNFHSKKV-MCIQQEIYARMIMYNFVQMITSHVVIVKKQRKHTYKA---------------------------NFSVATHMCRLFYREKTTSPNLETIIAKNLIPIRPD.... 82
7 -2.260PB001025 Q1QFV3_NITHX/1-288 PB001025; Pfam-B_1025;  ali follow..  55KTLQRLTKAEALRRIDRGLYDQPGFNKLTQKAANDLGLTDAVPAKIVVHTDARRRAIKLGNATITFRPTA-LVRDGESEQIQRKLAKLFEDPAVGPPLKADLAAGMTALPTWMLVF 220
8 -2.170HGC00921 gi|162841401|dbj|BABA01003308.1|3.0 TMP01242;  ali follow..  94........RMEIKESHKALYGLPVDNFSVPDLSSEASLAEWGQKIIE------GERKRTSQGGIPIYNPTIAKVKVHYDIFMEGYEKQKSLQSLTNRSLEQLASMRVQADRLILDI 195
9 -2.150PB000821 Q82P27_STRAW/1-209 PB000821; Pfam-B_821;  ali follow..  87LVASSVDGSRDIETIAHRVSGRFGRE.......................................................................................... 112
10 -2.030PB004996 Q5NNS6_ZYMMO/1-150 PB004996; Pfam-B_4996;  ali follow..  15  6VLFERLS---------SSFRRRFRLGVQEQQYLANKGMETILEHGKDFIAQRLGKQTPCKGHPV-AQHAGKSLSQEEQAYILDVIAHWLDL......................... 114

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Q, Zmasek CM, Dishaw LJ, Mueller MG, Ye Y, Litman GW, Godzik A. Novel genes dramatically alter regulatory network topology in amphioxus. Genome Biol.2008 Aug 4;9(8):R123.