current user: public

If you have questions about the server, please let us know.

Query: d2itka2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTELast
1 -3.790HGC00803 gi|163280588|dbj|BABD01030100.1|2.0 TMP01051;  ali follow..  20  35.....KVKDELQKVIDLLESGETDTEVIQETLDEAVCGINDLQEEFDENDSEIETVARD...................................................... 88
2 -2.870HGC00552 gi|162599220|dbj|BAAV01006262.1|2.0 TMP00636;  ali follow..  28  23...................................................................................MATTAFAAGTGDVAGAVESTW......... 43
3 -2.650PB032818 Q5LA03_BACFN/1-211 PB032818; Pfam-B_32818;  ali follow..  18  5................................ANLFKKQADADAKVVGNVEDFVSLTRVYFQSVIAVNLGDVANFKRLFKVATQGGKLGLAEKSASRKMLMQDYGI....... 86
4 -2.620PB015879 Q5LJ14_BACFN/120-411 PB015879; Pfam-B_15879;  ali follow..  10  32...KYNTTEPVVEARYEGELNPDMKAKIAELGKTDPKAAQEL-----YRSVSYHVDHGNGLD-GPTLGGGTTALMAGDTIVYPYCYATQELDNGPLRFTVKLVY......... 131
5 -2.550HGC00762 gi|162641591|dbj|BAAX01018014.1|1.0 TMP00997;  ali follow..  22  5.....KVSHQLKKLNNSSSLTKKNMTMEENTVHPARKLLL......................................................................... 39
6 -2.160PB007733 A3U921_9FLAO/1-209 PB007733; Pfam-B_7733;  ali follow..  10  26EGDTIPREFIDLEEVIILNKIKFTSDLERRRYLILRRKTRKVWPYAKLASERLSELNARLASIKSKSERRKYTKIVQKYIEEQFAAELKKLTRTELVKLIHRQTGFQLIK... 141
7 -1.980PB017610 Q11T14_CYTH3/22-188 PB017610; Pfam-B_17610;  ali follow..  12  2....................NRLGKIVFGLGIAVCLFSATNSIAQVKTHSENLEVILVKDIQHISDTTHHTHAHDPHKSSYKILH-VNFMLVSSDPSVTGYKSVMMRLI.... 93
8 -1.930PB001025 Q1QFV3_NITHX/1-288 PB001025; Pfam-B_1025;  ali follow..  18  13.........................SDMKSDSPDLKTAMLGRIRADEPRKSDFVDLASRDAVDKTLQRAEALRRIDRGLYDQP.............................. 77
9 -1.920PB202086 Q8G498_BIFLO/2-200 PB202086; Pfam-B_202086;  ali follow..  14  134................................DAAAVKLNEQADWYETHEKSLSKAVRAVVESKAAKRLDD----AKTNLTAKLDEALLADSDGKVAD............... 197
10 -1.820PB048276 _Gut.Meta.Jp.0112258_ gi|163310311|dbj|BABD01000385.1||2 (- 258:885~0 complete)  ali follow..  22  71..................................................................KQSGKLEHCLPSDLKNELDGVAFKASLGEFS................ 101

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.