current user: public

If you have questions about the server, please let us know.

Query: d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}, from SCOP207

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst ANKTRELCMKSLEHAKVDTSNEARQDGIDLYKHMFENYPPLRKYFKSREEYTAEDVQNDPFFAKQGQKILLACHVLCATYDDRETFNAYTRELLDRHARDHVHMPPEVWTDFWKLFEEYLGKKTTLDEPTKQAWHEIGREFAKEINKLast
1 -8.570sp|Q8IX21|F178A_HUMAN Protein FAM178A OS=Homo sapiens GN=FAM178A PE=1 SV=2  ali   15..........................GEEIFNKIFNQYTLDLRDSGFIGQSAVEKLILKSGKTDQIFLTTQGLTSAYHYVQCPVPVLKWLFRMMSVH------TDCIVSVQILSTLMEITIRNDTFSDSPVWPWIPSLSDVAAVFFN 135
2 -8.310tr|F5H085|F5H085_HUMAN Uncharacterized protein OS=Homo sapiens GN=CABIN1 PE=4 SV=1  ali   11  4..........................................RSRRGIWRIPVDEIDRPGSFAWHMNRSIVLLLKVLAQLRDHSTLLKVSSMLQR.................................................... 56
3 -8.310tr|B5MEB3|B5MEB3_HUMAN Calcineurin binding protein 1, isoform CRA_c OS=Homo sapiens GN=CABIN1 PE=4 SV=1  ali   11  4..........................................RSRRGIWRIPVDEIDRPGSFAWHMNRSIVLLLKVLAQLRDHSTLLKVSSMLQR.................................................... 56
4 -7.500sp|Q5TH69|BIG3_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Homo sapiens GN=ARFGEF3 PE=1 SV=3  ali   27SNCPRQHQPPTLDLLFELLRDVTKTPGPGFGIYAVVHLPVMSVWLRRSHKDHSYWDMASANFKHAIGLSCELVVEHIQSFLHSSMINTMLKDLFELLVACVAKPTETISRVGCSCIRYVLTAGPVFTEEM---WRLACCALQDAFSA 178
5 -7.130sp|Q7Z401|MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens GN=DENND4A PE=1 SV=2  ali   19.........................................QPLYILWNAHTQKYPMVHLLQKSDNSFNQELLKSMVKSIKMNDVYGPMSQILETLNKCPHFKRQRSLYREILFLSLVALGREDAFDKEYKMAYDRLTPSQVKSTHN 128
6 -7.080tr|E9PPP7|E9PPP7_HUMAN Uncharacterized protein OS=Homo sapiens GN=C8orf73 PE=4 SV=1  ali   2..VLADLALYTAACLEEAGFAGTQATVLTLSSAL----------------------ARGERLEDQVHALVRGLLAQVPSLAEGRPALRVLSALALEHAR--------------DVVCALLPRSLPADRVAAELWRSL.......... 104
7 -6.910sp|A6NGR9|CH073_HUMAN Putative uncharacterized protein C8orf73 OS=Homo sapiens GN=C8orf73 PE=2 SV=2  ali   2..VLADLALYTAACLEEAGFAGTQATVLTLSSAL----------------------ARGERLEDQVHALVRGLLAQVPSLAEGRPALRVLSALALEHAR--------------DVVCALLPRSLPADRVAAELWRSL.......... 104
8 -6.850sp|Q9Y6J0|CABIN_HUMAN Calcineurin-binding protein cabin-1 OS=Homo sapiens GN=CABIN1 PE=1 SV=1  ali   11  17PQHYKSLYRLAFLYTYSKTHRNLQWARDVLLGSLFCERNK-TNFFNGIWRIPVDEIDRPGSFAWHMNRSIVLLLKVLAQLRDHSTLLKV.......................................................... 118
9 -6.210sp|Q9H579|CT132_HUMAN Uncharacterized protein C20orf132 OS=Homo sapiens GN=C20orf132 PE=2 SV=2  ali   338SNELCQFIMTTFDTLKTLKHPCIQRSAGELLLTL---------------------AKNTESQFEKVPEIMGVICAQLSIISQPRVRQQIINTVRPKYTD--------------IVLSFLLCHPVPYNRHLAEVWRWILWRLLRKLQK 464
10 -5.890sp|Q0P6D6|CCD15_HUMAN Coiled-coil domain-containing protein 15 OS=Homo sapiens GN=CCDC15 PE=2 SV=2  ali   18  1............EALRAQIQEKMQLYNITL--------PPLCCCGPDFWDAHPDTCANNCIFYKNHRAYTRALHSFINSCDVPGTLRVAIHNFASAHRR................................................ 82

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 0 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.