current user: public

If you have questions about the server, please let us know.

Query: d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}, from SCOP207

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst ANKTRELCMKSLEHAKVDTSNEARQDGIDLYKHMFENYPPLRKYFKSREEYTAEDVQNDPFFAKQGQKILLACHVLCATYDDRETFNAYTRELLDRHARDHVHMPPEVWTDFWKLFEEYLGKKTTLDEPTKQAWHEIGREFAKEINKLast
1 -64.9001ash_A mol:protein length:150 HEMOGLOBIN (OXY)  ali model follow..  100  1ANKTRELCMKSLEHAKVDTSNEARQDGIDLYKHMFENYPPLRKYFKSREEYTAEDVQNDPFFAKQGQKILLACHVLCATYDDRETFNAYTRELLDRHARDHVHMPPEVWTDFWKLFEEYLGKKTTLDEPTKQAWHEIGREFAKEINK 147
2 -56.4002wtg_A mol:protein length:159 GLOBIN-LIKE PROTEIN  ali model follow..  39  5RQEISDLCVKSLEGRMVGTEAQNIENGNAFYRYFFTNFPDLRVYFKGAEKYTADDVKKSERFDKQGQRILLACHLLANVYTNEEVFKGYVRETINRHRIYKMDPAL--WMAFFTVFTGYLESVGSLNDQQKAAWMALGKEFNAESQT 149
3 -55.8001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  12  4SAAEADLAGKSWAPVF----ANKNANGLDFLVALFEKFPDSANFFADFKGKSVADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQF--ENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDALKA 144
4 -55.6001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  12  3SAAEADLAGKSWAPVF----ANKNANGDAFLVALFEKFPDSANFFADFKGKSVADIKASPKLRDHSSTIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQF--ENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDALKA 143
5 -54.3002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  14  5TNPQKAAIRSSWSKFM----DNGVSNGQGFYMDLFKAHPETLTPFKSFGGLTLAQLQDNPKMKAQSLVFCNGMSSFVDHLDDNDMLVVLIQKMAKLHNNRGIRASDL--RTAYDILIHYMEDHNHMVGGAKDAWEVFVGFICKTLGD 146
6 -53.6004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  12  10SEEQQSLIMEDVQVLL----PNYDDFVEDVLQQFMEENPETFQIFPWADASTAKEMRSHPRFKSHAKSIGKVISDCLVDLNGVKKHEPKLSSLGAMHTKKKVPTELFLGGCILTQVVKRVSE-AKWSEEKKEAWLKAYGIITVMVTE 154
7 -53.4003pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  17  5TGPQKAALKSSWSRFM----NNAVTNGTNFYMDLFKAYPDTLTPFKSFQNVSFNQMTNHPTMKAQSLVFCNGMSSFVDNLDDHEVLVVLLQKMAKLHFNRGIRIKEL--RDGYGVLLRYLEDHCHVEGSTKNAWEDFIAYICRVQGD 146
8 -53.1001x3k_A mol:protein length:152 hemoglobin component V  ali model follow..  10  6SDSEEKLVRDAWAPIH----GDLQGTANTVFYNYLKKYPSNQDKFETLKGHPLDEVKDTANFKLIAGRIFTIFDNCVKNVGNDKGFQKVIADMSGPHVARPITHGSY--NDLRGVIYDSMH----LDSTHGAAWNKMMDNFFYVFYE 142
9 -52.3002bk9_A mol:protein length:153 CG9734-PA  ali model follow..  14  2NSDEVQLIKKTWEIPV----ATPTDSGAAILTQFFNRFPSNLEKFP-FRDVPLEELSGNARFRAHAGRIIRVFDESIQVLGDLEKLDEIWTKIAVSHIPRTVSKESY--NQLKGVILDVLTAASSLDESQAATWAKLVDHVYAIIFK 144
10 -52.0002c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  15  2NSEEVNDIKRTWEVVA----AKMTEAGVEMLKRYFKKYPHNLNHFPWFKEIPFDDLPENARFKTHGTRILRQVDEGVKALSGDKKFDDVWKKLAQTHHEKKVERRSY--NELKDIIIEVVCSCVKLNEKQVHAYHKFFDRAYDIAFA 145
11 -51.5001ith_A mol:protein length:141 HEMOGLOBIN (CYANO MET)  ali model follow..  3TAAQIKAIQDHWFLN---IKGCLQAAADSIFFKYLTAYPGDLAFFHKFSSVPLYGLRSNPAYKAQTLTVINYLDKVVDALGGN--AGALMKAKVPSHDAMGITPKHF--GQLLKLVGGVFQEEFSADPTTVAAWGDAAGVLVAAMK. 141
12 -51.3001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  10  14TPAEKDLIRSTWDQLM----THRTGFVADVFIRIFHNDPTAQRKFPQMAGLSPAELRTSRQMHAHAIRVSALMTTYIDEMDT-EVLPELLATLTRTHDKNHVGKKNYFGKVLMEAIKAEL--GVGFTKQVHDAWAKTFAIVQGVLIT 155
13 -51.3001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  17  2ERPEPELIRQSWRAVS----RSPLEHGTVLFARLFALEPDLLPLFQYNQFSSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFVGESLLYMLEKSL--GPAFTPATRAAWSQLYGAVVQAMSR 146
14 -51.2001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  10  14TLAQKKIVRKTWHQLM----RNKTSFVTDVFIRIFAYDPSAQNKFPQMAGMSASQLRSSRQMQAHAIRVSSIMSEYVEELDS-DILPELLATLARTHDLNKVGADHYFAKVLMEALQAEL--GSDFNEKTRDAWAKAFSVVQAVLLV 155
15 -51.0002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  17  5ERPESELIRQSWRVVS----RSPLEHGTVLFARLFALEPSLLPLFQYNQFSSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFVGESLLYMLEKSL--GPDFTPATRTAWSRLYGAVVQAMSR 149
16 -51.0002vyw_A mol:protein length:148 HEMOGLOBIN  ali model follow..  15  4TQTQIDSILADLAHH-TDTTEHITEMGVSIYKTLFAAHPEYISYFSKLQGLTKDNVGQSEGIRYYGRTLGEELIRLLKAASNPSVLEERIVQGAKDHKARPVTKDQF--TGAAPIFIKFFQGLLK-KQEDKDAIEKFLLHVMQAIAA 146
17 -51.0004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  12  14NADQKDLLRMSWGVLS----VDMEGTGLMLMANLFKTSPSAKGKFARLGDV--SAGKDNSKLRGHSITLMYALQNFVDALDDVERLKCVVEKFAVNHINRQISADEFIVGPLRQTLKARM--GNYFDEDTVAAWASLVAVVQAAL.. 152
18 -50.9004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  12SEAIKANLRRSWGVLS----ADIEATGLMLMSNLFTLRPDTKTYFTRLGDV--QKGKANSKLRGHAITLTYALNNFVDSLDDPSRLKCVVEKFAVNHINRKISGDAFIVEPMKETLKARM--GNYYSDDVAGAWAALVGVVQAAL.. 150
19 -50.9004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  17  2ERPEPELIRQSWRAVS----RSPLEHGTVLFARLFALEPDLLPLFQYNQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFVGESLLYMLEKCL--GPAFTPATRAAWSQLYGAVVQAMSR 146
20 -50.4001h97_A mol:protein length:147 GLOBIN-3  ali model follow..  15  3TKHEQDILLKELGPH-VDTPAHIVETGLGAYHALFTAHPQYISHFSRLEGHTIENVMQSEGIKHYARTLTEAIVHMLKEISNDAEVKKIAAQYGKDHTSRKVTKDEFGEPIFTKYFQNLVKDAEG-KAAVEKFLKHVFPMMAAEI.. 147
21 -50.1001kfr_A mol:protein length:147 Hemoglobin  ali model follow..  15  3TKHEQDILLKELGPH-VDTPAHIVETGLGAYHALFTAHPQYISHFSRLEGHTIENVMQSDGIKHYARTLTEAIVHMLKEISNDAEVKKIAAQYGKDHTSRKVTKDEF--MSGEPIFTKYFQNLVA-DAEGKAAVEKFLKHVFPMMAA 145
22 -50.0002r4x_A mol:protein length:146 Globin-1  ali model follow..  11TADVKKDLRDSWKVIG----SDKKGNGVALMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGVSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEF--GKMNGPIKKVLA-SKNFGDKYANAWAKLVAVVQAAL.. 146
23 -49.9002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  14  11SEEKEALVLKSWAIMK----KDSANLGLRFFLKIFEIAPSARQMFPFLRD-SDVPLETNPKLKTHAVSVFVMTCEAAAQLRKAGKITTTLKRLGGTHLKYGVADGHFTRFALLETIKEALP-ADMWGPEMRNAWGEAYDQLVAAIKQ 156
24 -49.8003uh6_A mol:protein length:146 Globin-1  ali model follow..  11TADVKKDLRDSWKVIG----SDKKGNGVALMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGHSIALMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEF--GKINGPIKKVLA-SKNFGDKYANAWAKLVAVVQAAL.. 146
25 -49.8003uhd_A mol:protein length:146 Globin-1  ali model follow..  11TADVKKDLRDSWKVIG----SDKKGNGVALMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVAHITRKISAAEF--GKINGPIKKVLA-SKNFGDKYANAWAKLVAVVQAAL.. 146
26 -49.8003uhb_A mol:protein length:146 Globin-1  ali model follow..  11TADVKKDLRDSWKVIG----SDKKGNGVALMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITKKISAAEF--GKINGPIKKVLA-SKNFGDKYANAWAKLVAVVQAAL.. 146
27 -49.8003ugz_A mol:protein length:146 Globin-1  ali model follow..  11TADVKKDLRDSWKVIG----SDKKGNGVAAMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEF--GKINGPIKKVLA-SKNFGDKYANAWAKLVAVVQAAL.. 146
28 -49.7003uhi_A mol:protein length:146 Globin-1  ali model follow..  11TADVKKDLRDSWKVIG----SDKKGNGVALMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVERFAVNHITRKISAAEF--GKINGPIKKVLA-SKNFGDKYANAWAKLVAVVQAAL.. 146
29 -49.7001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  18  4TESQAALVKSSWEEFN----ANIPKHTHRFFILVLEIAPAAKDLFSFLKG-TSEVPQNNPELQAHAGKVFKLVYEAAIQLEVTGVTDATLKNLGSVHVSKGVADAHFVKEAILKTIKEVV--GAKWSEELNSAWTIAYDELAIVIKK 147
30 -49.7001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  11TADVKKDLRDSWKVIG----SDKKGNGVALMTTLFADNQETIGYFKRLGNV--SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEF--GKINGPIKKVLA-SKNFGDKYANAWAKLVAVVQAAL.. 146
31 -49.7003ugy_A mol:protein length:146 Globin-1  ali model follow..  11TADVKKDLRDSWKVIG----SDKKGNGVALMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGHSITLMYALQNYIDQLDNPDDLVCVVEKFAVNHITRKISAAEF--GKINGPIKKVLA-SKNFGDKYANAWAKLVAVVQAAL.. 146
32 -49.7003uhc_A mol:protein length:146 Globin-1  ali model follow..  11TADVKKDLRDSWKVIG----SDKKGNGVALMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGHSITLMYALQAFIDQLDNPDDLVCVVEKFAVNHITRKISAAEF--GKINGPIKKVLA-SKNFGDKYANAWAKLVAVVQAAL.. 146
33 -49.7002auo_A mol:protein length:146 Globin I  ali model follow..  11TADVKKDLRDSWKVIG----SDKKGNGVALMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKYAVNHITRKISAAEF--GKINGPIKKVLA-SKNFGDKYANAWAKLVAVVQAAL.. 146
34 -49.7002grf_A mol:protein length:146 Globin-1  ali model follow..  11TADVKKDLRDSWKVIG----SDKKGNGVALVTTLFADNQETIGYFKRLGDV--SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEF--GKINGPIKKVLA-SKNFGDKYANAWAKLVAVVQAAL.. 146
35 -49.6002r4z_A mol:protein length:146 Globin-1  ali model follow..  11TADVKKDLRDSWKVWG----SDKKGNGVALMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEF--GKINGPIKKVLA-SKNFGDKYANAWAKLVAVVQAAL.. 146
36 -49.6002qfn_A mol:protein length:138 Dehaloperoxidase A  ali model follow..  12  2......GFKQDIATIR----GDLRTYAQDIFLAFLNKYPDERRYFKNYVGKSDQELKSMAKFGDHTEKVFNLMMEVADRATDSVPLASDANTLVQMKQHSSLTTGNF--EKLFVALVEYMRA--SGQSFDSQSWDRFGKNLVSALSS 134
37 -49.5001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  13  15SEEQEALVLKSWAILK----KDSANIALRFFLKIFEVAPSASQMFSFLRN-SDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHLKYGVGDAHFVKFALLDTIKEEVP-ADMWSPAMKSAWSEAYDHLVAAIKQ 160
38 -49.4002d2m_B mol:protein length:142 Giant hemoglobin, A2(a5) globin chain  ali model follow..  15  3TSLNRLLVKRQWAEAY-GEGTNRELLGNRIWEDLFANMPDARGLFSRVN----GNDIDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDSRGIPAAGY--PAFVASAISAVRATVGARSFDNDAWNSCMNQIVSGIS. 141
39 -49.4004jac_A mol:protein length:138 Dehaloperoxidase A  ali model follow..  12  2......GFKQDIATIR----GDLRTYAQDIFLAFLNKYPDERRYFKNYVGKSDQELKSMAKFGDHSEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNF--EKLFVALVEYMRA--SGQSFDSQSWDRFGKNLVSALSS 134
40 -49.2003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  11  11TEEQEALVVKAWAVMK----KNSAELGLQFFLKIFEIAPSAKNLFSYLKDSP-VPLEQNPKLKPHATTVFVMTCESAVQLRKAGVKESDLKRIGAIHFKTGVVNEHFTRFALLETIKEAV--PEMWSPEMKNAWGVAYDQLVAAIKF 155
41 -49.2001x46_A mol:protein length:150 hemoglobin component VII  ali model follow..  15  8EAGDIALVKSSWAQIH--------DKEVDILYNFFKSYPASQAKFSAFAGKDLESLKDTAPFALHATRIVSVINEAIALMENRPALKNVLKQQGINHKGRGVTAAHF--EEFETALEAFLESASGYNAGTKKAWDSAFNNMYSVVFP 148
42 -49.1003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  13  11TEEQEALVVKSWAVMK----KNSAELGLKFFLKIFEIAPSAKNLFSYLKDSP-IPLEQNPKLKPHAMTVFVMTCESAVQLRKAGVRESNLKRLGAIHFKNGVVNEHFTRFALLETIKEAV--PEMWSPEMKNAWGEAYDQLVAAIKS 155
43 -49.1003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  14  10TEEQEALVVKSWSVMK----KNSAELGLKLFIKIFEIAPTTKKMFSFLRDSP-IPAEQNPKLKPHAMSVFVMCCESAVQLRKTGVRETTLKRLGASHSKYGVVDEHFAKYALLETIKEAV--PEMWSPEMKVAWGQAYDHLVAAIKA 154
44 -48.9003mym_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  12  1......GFKQDIATIR----GDLRTYAQDIFLAFLNKYPDERRYFKNYVGKSDQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQEKQHSSLTTGN--FEKLFVALVEYMRA--SGQSFDSQSWDRFGKNLVSALSS 133
45 -48.9002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  15  14GEEQEALVLKSWAVMK----KDAANLGLRFFLKVFEIAPSAKQMFSFLRDSD-VPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHLRYGVADGHFTGFALLETIKEALP-ADMWSLEMKKAWAEAYSQLVAAIKR 159
46 -48.8003oj1_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  12  2.......FKQDIATIR----GDLRTYAQDIFLAFLNKYPDERRYFKNYVGKSDQELKSMAKFGDDTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGN--FEKLFVALVEYMRA--SGQSFDSQSWDRFGKNLVSALSS 133
47 -48.8003k3u_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  12  2.......FKQDIATIR----GDLRTYAQDIFLAFLNKYPDERRYFKNYVGKSDQELKSMAKFGDHTEKWFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGN--FEKLFVALVEYMRA--SGQSFDSQSWDRFGKNLVSALSS 133
48 -48.8001flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  13  3EAAQKSNVTSSWAKAS----AAWGTAGPEFFMALFDAHDDVFAKFSGFSGAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLAFKVLSGFMKSYGGD--------EGAWTAVAGALMGEIEP 140
49 -48.8001ebt_A mol:protein length:142 HEMOGLOBIN  ali model follow..  13  3SAAQKDNVTSSWAKAS----AAWGTAGPEFFMALFDAHDDVFAKFSGFSGAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLAFKVLSGFMKSYGGD--------EGAWTAVAGALMGEIEP 140
50 -48.7003ixf_A mol:protein length:137 Dehaloperoxidase B  ali model follow..  11  2.......FKQDIATLR----GDLRTYAQDIFLAFLNKYPDEKRNFKNYVGKSDQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDASTLVQMKQHSGLTTGNF--EKLFVALVEYMRA--SGQSFDSQSWDRFGKNLVSALSS 133
51 -48.7001b0b_A mol:protein length:142 HEMOGLOBIN  ali model follow..  13  3SAAQKDNVKSSWAKAS----AAWGTAGPEFFMALFDAHDDVFAKFSGFSGAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLAFKVLAGFMKSYGGD--------EGAWTAVAGALMGMIRP 140
52 -48.4004kmw_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  12  2.......FKQDIATIR----GDLRTYAQDIFLAFLNKYPDERRNFKNYVGKSDQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGN--FEKLFVALVEYMRA--SGQSFDSQSWDRFGKNLVSALSS 133
53 -48.4005v5r_B mol:protein length:137 Dehaloperoxidase A  ali model follow..  12  2.......FKQDIATLR----GDLRTYAQDIFLAFLNKYPDERRYFKNYVGKSDQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNF--EKLFVALVEYMRA--SGQSFDSQSWDRFGKNLVSALSS 133
54 -48.2001hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  13  3SAAQRQVIAATWKDIA--GADNGAGVGKKCLIKFLSAHPQMAAVFGFSG-------ASDPGVAALGAKVLAQIGVAVSHLGDEGKMVAQMKAVGVRHKGYGNHIKAQYFEPLGASLLSAMEHGGKMNAAAKDAWAAAYADISGALIS 143
55 -48.1003wct_B mol:protein length:144 A2 globin chain of giant V2 hemoglobin  ali model follow..  17  4GPLQRLKVKRQWAEAYG-SGNGREEFGHFIWANVFKVAPSARDMFKRVR----GDNIYTPAFRAHATRVLGGLDMCVALLDDESVLNTQLAHLASQHSSRGVSAEQY--NVVEHAVMMGVEHEIGQNVFDKDAWQACLDVITSGIQG 143
56 -48.1001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  18  4TEKQDALVSSSFEAFK----ANIPQYSVVFYTSILEKAPAAKDLFSFLAN---GVDPTNPKLTGHAEKLFALVRDSAGQLKASGTV-VADAALGSVHAQKAVTDPQFVKEALLKTIKAAV--GDKWSDELSRAWEVAYDELAAAIKK 142
57 -47.9004hsw_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  13  2.......FKQDIATIR----GDLRTYAQDIFLAFLNKYPDERRYFKNYVGKSDQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNF--EKFFVALVEYMRA--SGQSFDSQSWDRFGKNLVSALSS 133
58 -47.8001spg_B mol:protein length:147 HEMOGLOBIN  ali model follow..  4TDAERAAIKALWGKI------DVGEIGPQALSRLLIVYPWTQRHFKGFGNISNAAILGNAKVAEHGKTVMGGLDRAVQNMDNIKNVYKQLSIKHSEKIHVDPDNFRLLGEIITMCVGAKFG-PSAFTPEIHEAWQKFLAVVVSALGR 144
59 -47.7002d2m_A mol:protein length:140 Giant hemoglobin, A1(b) globin chain  ali model follow..  18  3NRLEQILVKTQWAQSYG-EAENRAAFSRDLFSELFNIQGSSRALFSGVG----VDDMNSAAFTAHCLRVTGALNRLISQLDQQATINADLAHLAGQHASRNLDASNF--AAMGQAVMSVVPT--HLDCFNQHAWGECYERIASGIS. 139
60 -47.6001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  13  3SAAQRQVVASTWKDIA--GADNGAGVGKECLSKFISAHPEMAAVFGFSG-------ASDPGVAELGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFLGASLLSAMEHRI--GGKMNAAAKDAWAAAYGDISGALIS 143
61 -47.6001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  13  3SAAQRQVVASTWKDIA--GSDNGAGVGKECFTKFLSAHHDMAAVFGFSG-------ASDPGVADLGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFLGASLLSAMEHRI--GGKMNAAAKDAWAAAYADISGALIS 143
62 -47.5001yhu_B mol:protein length:144 Giant hemoglobins B chain  ali model follow..  17  5GPLQRLKVKRQWAEAYG-SGNSREEFGHFIWSHVFQHSPAARDMFKRVR----GDNIHTPAFRAHATRVLGGLDMCIALLDDEPVLNTQLAHLAKQHETRGVEAAHY--DTVNHAVMMGVENVIGSEVFDQDAWKPCLNVITNGIQ. 143
63 -47.4001myt_A mol:protein length:146 MYOGLOBIN  ali model follow..  13  1..ADFDAVLKCWGPVE----ADYTTMGGLVLTRLFKEHPETQKLFPKFAGIAQADIAGNAAISAHGATVLKKLGELLKAKGS---HAAILKPLANSHATK-HKIPINNFKLISEVLVKVMHEKAGLDAGGQTALRNVMGIIIADLEA 137
64 -47.1001umo_A mol:protein length:190 CYTOGLOBIN  ali model follow..  12  20SEAERKAVQAMWARLY----ANSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDLEMERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAHAKHKVEPVYFLSGVILEVVAEEF--ASDFPPETQRAWAKLRGLIYSHVTA 164
65 -47.0004u8u_D mol:protein length:141 Globin d Chain  ali model follow..  21  3SILELLKVKNQWREAFG-EGHHRVQFGLELWKRFFDTHPEVKGLFKGVN----GDNIYSPEFAAHAERVLSGLDMTIGLLDDTNAFKAQVTHLHSQHVERSINPEFYFLGALLHVLPKYL--GTKLDQD---AWTKCFHTIADGIK. 140
66 -47.0002nrl_A mol:protein length:147 Myoglobin  ali model follow..  13  1.XADFDAVLKCWGPVE----ADYTTIGGLVLTRLFKEHPETQKLFPKFAGIAQADIAGNAAVSAHGATVLKKLGELLKAKGS---HAAILKPLANSHATK-HKIPINNFKLISEVLVKVMQEKAGLDAGGQTALRNVMGIIIADLEA 138
67 -46.9001ch4_A mol:protein length:146 MODULE-SUBSTITUTED CHIMERA HEMOGLOBIN BETA-ALPHA  ali model follow..  13  4TPEEKSAVTALWGKV------NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLRVDPVNFKLLSHCLLVTLAAHL--PAEFTPAVHASLDKVLASVSTVLTS 143
68 -46.8001eca_A mol:protein length:136 ERYTHROCRUORIN (AQUO MET)  ali model follow..  15  2SADQISTVQASFDKVK--------GDPVGILYAVFKADPSIMAKFTQFAGKDLESIKGTAPFETHANRIVGFFSKIIGELPN---IEADVNTFVASHKPRGVTHDQL--NNFRAGFVSYMKAHTD-FAGAEAAWGATLDTFFGMIFS 134
69 -46.6001g0b_B mol:protein length:146 HEMOGLOBIN BETA CHAIN  ali model follow..  10  4SGEEKAAVLALWDKV------NEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDKLHVDPENFRLLGNVLVVVLARHF--GKDFTPELQASYQKVVAGVANALAH 143
70 -46.5003wct_A mol:protein length:146 A1 globin chain of giant V2 hemoglobin  ali model follow..  17  3NILQRLKVKMQWAKAYG-FGTERAKFGNSLWTSIFNYAPDARDLFKSVK----SEDMRSPQFKAHIARVIGGLDRVISMFDNEDALNADLEHLKSQHDPRGLDALNFFGKALFATVGGQF--GVCFDLP---AWESCYKVIAMGITG 141
71 -46.4003gdj_B mol:protein length:146 Hemoglobin subunit beta  ali model follow..  14  4SGDEKNAVHGLWSKVK------VDEVGGEALGRLLVVYPWTRRFFESFGDLSADAVMNNPKVKAHGSKVLNSFGDGLNHLDNLKGTYAKLSELHCDKLHVDPENFRLLGNVLVVVLARHF--GKEFTPDLQAAYQKVVAGVANALAH 143
72 -46.3003mjp_B mol:protein length:146 Hemoglobin subunit beta  ali model follow..  12  4SAEEKQLITGLWGKV------NVAECGAEALARLLIVYPWTQRFFASFGNLSPTAILGNPMVRAHGKKVLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHF--TKDFTPECQAAWQKLVRVVAHALAR 143
73 -46.3001x9f_D mol:protein length:140 hemoglobin chain d1  ali model follow..  15  3LVTESLKVKLQWASAFG-HAHERVAFGLELWRDIIDDHPEIKAPFSRVR----GDNIYSPEFGAHSQRVLSGLDITISMLDTPDMLAAQLAHLKVQHVERNLKPEFFFLKHLLHVLGDRLGTH------DFGAWHDCVDQIIDGIK. 140
74 -46.2001x9f_B mol:protein length:145 Globin II, extracellular  ali model follow..  15  5GVLEGLKVKSEWGRAYG-SGHDREAFSQAIWRATFAQVPESRSLFKRVH----GDDTSHPAFIAHADRVLGGLDIAISTLDQPATLKEELDHLQVQHEGRKIPDNYFFKTAILHVVAAQL--GRCYDRE---AWDACIDHIEDGIKG 143
75 -46.1004u8u_B mol:protein length:142 Globin b Chain  ali model follow..  17  4DVLTRLKVKAQWRRAY-SHGHNREDFAQAIWRALFAQVPDSRTLFKRVH----GHDTTSPEFQAHALRVLAGFDIAISTLDQPDALKAELDHLEKQHEGRHIPDNYFFKTALLHVLPAQL--GRCWDKD---AWSACFDHIAHGIK. 141

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.