current user: public

If you have questions about the server, please let us know.

Query: d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}, from SCOP207

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst HEHCCSEEDHRIVQKQWDILWRDTESSKIKIGFGRLLLTKLAKDIPEVNDLFKRVDIEHAEGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQHEVREGVQKAHFKKFGEILATGLPQVLDDYDALAWKSCLKGILTKISSRLLast
1 -63.5001x9f_C mol:protein length:153 Globin III, extracellular  ali model follow..  100  3HEHCCSEEDHRIVQKQWDILWRDTESSKIKIGFGRLLLTKLAKDIPEVNDLFKRVDIEHAEGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQHEVREGVQKAHFKKFGEILATGLPQVLDDYDALAWKSCLKGILTKISSRL 151
2 -62.4004u8u_C mol:protein length:151 Globin c Chain  ali model follow..  71  1HQFCCSAEDRNIVQKQWSVLWGDTESSKVKIAFGRLILTKLAKEIPEVKELFNKVDIDNPEGGPFSAHCLRILNALDMSINLMDDPEALDSALDHLADQHHDRPGVKKAHFKKIAEILHTGLQQVLDDYNALSWKSCFKGILGKIASKL 149
3 -62.1001yhu_C mol:protein length:148 hemoglobin B1a chain  ali model follow..  40  4....CADAAAAIVQAQWEDVWSAAAAAASRVSAGEEVFAALFKMVPAAKNLFTRVNVADINSPEFQGHVVRVMGGLDILINALDDIPTLESMLDHLAGQHAVRDGVTGAGFQLMATVLMESLPQVVEGFNPDAWASCLAGIAAAISSAL 148
4 -60.4004u8u_A mol:protein length:150 Globin a chain  ali model follow..  35  1DDDCCSAEDRREIQHIWDTVWSSS-FTDRKVAIAGAVFKDLFHHYPSAKGLFERVKVAEPDSGEYHSHLVRVANGLDLLINLFQDTQVLDKQLAHLAEQHILRKGVTQQFFKGIGESFARVFPQVSSCFNLEAWNRCFHTLADRISRDL 148
5 -59.8003wct_D mol:protein length:149 B1 globin chain of giant V2 hemoglobin  ali model follow..  34  1.SEFCSEADATIVIKQWNQIYNAGIGAKSRWTMGNEIFSSLFKLKPESEVLFNNVNVANMSSGAFHAHTVRVLSGLDMGINYLNDAGTLTSLTAHLAAQHVARTGLKAVYFDAMGKVLMTVLPSLIDNFNPDAWRNCLLPLKNAIAKGL 148
6 -59.6002d2m_C mol:protein length:147 Giant hemoglobin, B2(c) globin chain  ali model follow..  34  1.SSCCSSEDRANVMHNWDAAWSAA-YSDRRVALAQAVFASLFSRDAAAQGLFSGVSADNPDSADFRAHCVRVVNGLDVAINMLNDPAVLNEQLAHLSAQHQARAGVAAAHFDVMAEAFAEVMPQVSSCFSSDSWNRCFARIANGISAGL 147
7 -59.2001x9f_A mol:protein length:151 Globin IV, extracellular  ali model follow..  39  4.EDCCSYEDRREIRHIWDDVWSSSF-TDRRVAIVRAVFDDLFKHYPTSKALFERVKIDEPESGEFKSHLVRVANGLKLLINLLDDTLVLQSHLGHLADQHIQRKGVTKEYFRGIGEAFARVLPQVLSCFNVDAWNRCFHRLVARIAKDL 150
8 -59.1002zfo_D mol:protein length:145 Extracellular giant hemoglobin major globin subunit B1  ali model follow..  25  1..ECCSRGDAEVVISEWDQVFNAAMAGSSESAIGVAIFDVFFTSSGVSPSMFPGGGD--SSSAEFLAQVSRVISGADIAINSLTNRATCDSLLSHLNAQHKAISGVTGAAVTHLSEAISSVVAQVLPSAHIDAWGYCMAYIAAGIGAGL 145
9 -58.9001yhu_D mol:protein length:149 hemoglobin B2 chain  ali model follow..  32  4....CTTEDRREMQLMWGNVWSAQF-TGRRIAIAQAVFKDLFANVPDAVGLFGAVKGDEVNSNEFKAHCIRVVNGLDSSIGLLSDPATLNEQLSHLATQHKARSGVTKGGFSAIAQSFLRVMPQVASCFNPDAWSRCFNRITTGMTEPL 147
10 -58.9002d2m_D mol:protein length:145 Giant hemoglobin, B1(d) globin chain  ali model follow..  25  1..ECCSRGDAEVVISEWDQVFNAAMAGSSESAVGVAIFDAFFASSGVSPSMFPGGGD--SNNPEFLAQVSRVVSGADIAINSLTNRATCDSLLSHLNAQHRAISGVTGAAVTHLSQAISSVVAQVLPSAHIDAWEYCMAYIAAGIGAGL 145
11 -57.3003wct_C mol:protein length:150 B2 globin chain of giant V2 hemoglobin  ali model follow..  31  2.SNSCTTEDRREMQLMWANVWSAQ-FTGRRLAIAQAVFKDLFAHVPDAVGLFDRVHGTEIDSSEFKAHCIRVVNGLDSAIGLLSDPSTLNEQLSHLATQHQERAGVTKGGFSAIAQSFLRVMPQVASCFNPDAWSRCFNRITNGMTEGL 148
12 -56.1002d2m_A mol:protein length:140 Giant hemoglobin, A1(b) globin chain  ali model follow..  28  2....CNRLEQILVKTQWAQSYGEAE---NRAAFSRDLFSELFNIQGSSRALFSGVGVDDMNSAAFTAHCLRVTGALNRLISQLDQQATINADLAHLAGQHAS-RNLDASNFAAMGQAVMSVVPTHLDCFNQHAWGECYERIASGISG.. 140
13 -54.4001x9f_B mol:protein length:145 Globin II, extracellular  ali model follow..  29  1.KKQCGVLEGLKVKSEWGRAYGSGHDR---EAFSQAIWRATFAQVPESRSLFKRVHGDDTSHPAFIAHADRVLGGLDIAISTLDQPATLKEELDHLQVQHEG-RKIPDNYFDAFKTAILHVVAAQLGRCDREAWDACIDHIEDGIKGH. 144
14 -54.4001yhu_B mol:protein length:144 Giant hemoglobins B chain  ali model follow..  34  1.DYVCGPLQRLKVKRQWAEAYGSGNSR---EEFGHFIWSHVFQHSPAARDMFKRVRGDNIHTPAFRAHATRVLGGLDMCIALLDDEPVLNTQLAHLAKQHET-RGVEAAHYDTVNHAVMMGVENVIGSEVQDAWKPCLNVITNGIQG.. 144
15 -54.0003wct_A mol:protein length:146 A1 globin chain of giant V2 hemoglobin  ali model follow..  32  2....CNILQRLKVKMQWAKAYG---FGTERAKFGNSLWTSIFNYAPDARDLFKSVKSEDMRSPQFKAHIARVIGGLDRVISMFDNEDALNADLEHLKSQHDP-RGLDALNFVVFGKALFATVGGQFGVCDLPAWESCYKVIAMGITGND 143
16 -53.7001yhu_A mol:protein length:145 hemoglobin A1 chain  ali model follow..  27  2....CAMLERAKVKDEWAKAYG---IGAARSKFGDALWRNVFNYAPNARDIFESVNSKDMASPEFKAHIARVLGGLDRVISMLDNQATLDADLAHLKSQHDP-RTIDPVNFVVFRKALIATVAGTFGVCDVPAWQGCYNIIAKGITGSD 143
17 -53.6003wct_B mol:protein length:144 A2 globin chain of giant V2 hemoglobin  ali model follow..  30  3....CGPLQRLKVKRQWAEAYGSGNGR---EEFGHFIWANVFKVAPSARDMFKRVRGDNIYTPAFRAHATRVLGGLDMCVALLDDESVLNTQLAHLASQHSS-RGVSAEQYNVVEHAVMMGVEHEIGQNVKDAWQACLDVITSGIQGN. 144
18 -53.4004u8u_B mol:protein length:142 Globin b Chain  ali model follow..  35  3....CDVLTRLKVKAQWRRAYSHGHNR---EDFAQAIWRALFAQVPDSRTLFKRVHGHDTTSPEFQAHALRVLAGFDIAISTLDQPDALKAELDHLEKQHEG-RHIPDNYFDAFKTALLHVLPAQLGRCDKDAWSACFDHIAHGIKG.. 142
19 -53.4002d2m_B mol:protein length:142 Giant hemoglobin, A2(a5) globin chain  ali model follow..  29  2....CTSLNRLLVKRQWAEAYGEGTNR---ELLGNRIWEDLFANMPDARGLFSRVNGNDIDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDS-RGIPAAGYPAFVASAISAVRATVGARDNDAWNSCMNQIVSGISG.. 142
20 -53.3004u8u_D mol:protein length:141 Globin d Chain  ali model follow..  33  2....CSILELLKVKNQWREAFGEGH---HRVQFGLELWKRFFDTHPEVKGLFKGVNGDNIYSPEFAAHAERVLSGLDMTIGLLDDTNAFKAQVTHLHSQHVE-RSINPEFYEHFLGALLHVLPKYLGTKDQDAWTKCFHTIADGIKG.. 141
21 -52.4001x9f_D mol:protein length:140 hemoglobin chain d1  ali model follow..  31  2....CLVTESLKVKLQWASAFGHAHER---VAFGLELWRDIIDDHPEIKAPFSRVRGDNIYSPEFGAHSQRVLSGLDITISMLDTPDMLAAQLAHLKVQHVE-RNLKPEFFDIFLKHLLHVLGDRLGTHDFGAWHDCVDQIIDGIK... 140
22 -52.2001umo_A mol:protein length:190 CYTOGLOBIN  ali model follow..  19  19....LSEAERKAVQAMWARLYANSE------DVGVAILVRFFVNFPSAKQYFSQFKHEMERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAPETQRAWAKLRGLIYSHVTAAY 166
23 -51.7002lhb_A mol:protein length:149 HEMOGLOBIN V (CYANO MET)  ali model follow..  19  11....LSAAEKTKIRSAWAPVYSTYE------TSGVDILVKFFTSTPAAQEFFPKFKDELKKSADVRWHAERIINAVDDAVASMDDTEKMSMKLRNLSGKHAKSFQVDPEYFKVLAAVIADTVAA-----GDAGFEKLMSMICILLRSA. 148
24 -51.4001f5o_A mol:protein length:149 HEMOGLOBIN V  ali model follow..  18  11....LSAAEKTKIRSAWAPVYSTYE------TSGVDILVKFFTSTPAAQEFFPKFKDQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRDLSGKHAKSFQVDPQYFKVLAAVIADTVAA-----GDAGFEKLMSMICILLRSA. 148
25 -51.4001uc3_A mol:protein length:149 Globin  ali model follow..  18  11....LSAAEKTKIRSAWAPVYSNYE------TSGVDILVKFFTSTPAAQEFFPKFKDQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRDLSGKHAKSFQVDPQYFKVLAAVIADTVAA-----GDAGFEKLMSMICILLRSA. 148
26 -51.0004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  19  9....VSEEQQSLIMEDVQVLLPNYD------DFVEDVLQQFMEENPETFQIFPWADKEMRSHPRFKSHAKSIGKVISDCLVDLNGVKKHEPKLSSLGAMHT-KKKVPTELFGKLGGCILTQVVKRVSEEKKEAWLKAYGIITVMVTE.. 154
27 -50.9002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  19  2..SHMERPESELIRQSWRVVSRSPL------EHGTVLFARLFALEPSLLPLFQYNGEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRA-VGVRLSSFSTVGESLLYMLEKSLGPATRTAWSRLYGAVVQAMSRGW 151
28 -50.8001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  20  1....MERPEPELIRQSWRAVSRSPL------EHGTVLFARLFALEPDLLPLFQYNGEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRA-VGVKLSSFSTVGESLLYMLEKSLGPATRAAWSQLYGAVVQAMSRGW 148
29 -50.7001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  18  1..XSLSAAEADLAGKSWAPVFANKN------ANGLDFLVALFEKFPDSANFFADFKADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHV-GFGVGSAQFENVRSMFPGFVASVAAAGADAAWTKLFGLIIDALKAA. 145
30 -50.7001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  18  2....LSAAEADLAGKSWAPVFANKN------ANGDAFLVALFEKFPDSANFFADFKADIKASPKLRDHSSTIFTRLNEFVNNAANAGKMSAMLSQFAKEHVG-FGVGSAQFENVRSMFPGFVASVAAAGADAAWTKLFGLIIDALKAAG 145
31 -50.6004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  20  1....MERPEPELIRQSWRAVSRSPL------EHGTVLFARLFALEPDLLPLFQYNPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRA-VGVKLSSFSTVGESLLYMLEKCLGPATRAAWSQLYGAVVQAMSRGW 148
32 -50.5001v5h_A mol:protein length:193 Cytoglobin  ali model follow..  19  22....LSEAERKAVQAMWARLYANCE------DVGVAILVRFFVNFPSAKQYFSQFKHEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAPETQRAWAKLRGLIYSHVTAAY 169
33 -50.4001flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  14  1...SLEAAQKSNVTSSWAKASAAWG------TAGPEFFMALFDAHDDVFAKFSGLKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKA-RGISAGQLEAAFKVLSGFMKSYGGDE--GAWTAVAGALMGEIEPDM 142
34 -50.4001ebt_A mol:protein length:142 HEMOGLOBIN  ali model follow..  15  1...SLSAAQKDNVTSSWAKASAAWG------TAGPEFFMALFDAHDDVFAKFSGLKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKA-RGISAGQLEAAFKVLSGFMKSYGGDE--GAWTAVAGALMGEIEPNM 142
35 -50.3001b0b_A mol:protein length:142 HEMOGLOBIN  ali model follow..  16  1...SLSAAQKDNVKSSWAKASAAWG------TAGPEFFMALFDAHDDVFAKFSGLKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKA-RGISAGQLEAAFKVLAGFMKSYGGDE--GAWTAVAGALMGMIRPDM 142
36 -50.3002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  17  1.XTTLTNPQKAAIRSSWSKFMDNGV------SNGQGFYMDLFKAHPETLTPFKSLLAQLQDNPKMKAQSLVFCNGMSSFVDHLDDNDMLVVLIQKMAKLHN-NRGIRASDLRTAYDILIHYMEDHMVGGAKDAWEVFVGFICKTLGDYM 148
37 -50.2004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  19  13....SNADQKDLLRMSWGVLSVDME------GTGLMLMANLFKTSPSAKGKFARLGDAGKDNSKLRGHSITLMYALQNFVDALDDVERLKCVVEKFAVNHI-NRQISADEFGEIVGPLRQTLKARMGEDTVAAWASLVAVVQAAL.... 152
38 -50.0003pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  17  4....LTGPQKAALKSSWSRFMNNAV------TNGTNFYMDLFKAYPDTLTPFKSLFNQMTNHPTMKAQSLVFCNGMSSFVDNLDDHEVLVVLLQKMAKLHF-NRGIRIKELRDGYGVLLRYLEDHCHGSTKNAWEDFIAYICRVQGDFM 148
39 -49.9002grf_A mol:protein length:146 Globin-1  ali model follow..  21  10....LTADVKKDLRDSWKVIGSDKK------GNGVALVTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLAKNFGDKYANAWAKLVAVVQAAL.... 146
40 -49.9001x3k_A mol:protein length:152 hemoglobin component V  ali model follow..  15  5....LSDSEEKLVRDAWAPIHGDLQ------GTANTVFYNYLKKYPSNQDKFETLKDEVKDTANFKLIAGRIFTIFDNCVKNVGNDKGFQKVIADMSGPHV-ARPITHGSYNDLRGVIYDSMH--LDSTHGAAWNKMMDNFFYVFYECL 144
41 -49.9003uhi_A mol:protein length:146 Globin-1  ali model follow..  21  10....LTADVKKDLRDSWKVIGSDKK------GNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVERFAVNHI-TRKISAAEFGKINGPIKKVLAKNFGDKYANAWAKLVAVVQAAL.... 146
42 -49.9003uhb_A mol:protein length:146 Globin-1  ali model follow..  21  10....LTADVKKDLRDSWKVIGSDKK------GNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHI-TKKISAAEFGKINGPIKKVLAKNFGDKYANAWAKLVAVVQAAL.... 146
43 -49.9001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  21  10....LTADVKKDLRDSWKVIGSDKK------GNGVALMTTLFADNQETIGYFKRLGSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLAKNFGDKYANAWAKLVAVVQAAL.... 146
44 -49.9004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  21  11....GSEAIKANLRRSWGVLSADIE------ATGLMLMSNLFTLRPDTKTYFTRLGQKGKANSKLRGHAITLTYALNNFVDSLDDPSRLKCVVEKFAVNHI-NRKISGDAFGAIVEPMKETLKARMGDDVAGAWAALVGVVQAAL.... 150
45 -49.8001cg5_A mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  20  2....LSSQNKKAIEELGNLIKANAE------AWGADALARLFELHPQTKTYFSKFSGFEACNEQVKKHGKRVMNALADATHHLDN---LHLHLEDLARKHGENLLVDPHNFHLFADCIVVTLAVNLTPVTHCAVDKFLELVAYELSSCY 140
46 -49.8003uh6_A mol:protein length:146 Globin-1  ali model follow..  21  10....LTADVKKDLRDSWKVIGSDKK------GNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSIALMYALQNFIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLAKNFGDKYANAWAKLVAVVQAAL.... 146
47 -49.8003uhd_A mol:protein length:146 Globin-1  ali model follow..  21  10....LTADVKKDLRDSWKVIGSDKK------GNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVAHI-TRKISAAEFGKINGPIKKVLAKNFGDKYANAWAKLVAVVQAAL.... 146
48 -49.8002r4x_A mol:protein length:146 Globin-1  ali model follow..  21  10....LTADVKKDLRDSWKVIGSDKK------GNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGVSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKMNGPIKKVLAKNFGDKYANAWAKLVAVVQAAL.... 146
49 -49.8003ugz_A mol:protein length:146 Globin-1  ali model follow..  21  10....LTADVKKDLRDSWKVIGSDKK------GNGVAAMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLAKNFGDKYANAWAKLVAVVQAAL.... 146
50 -49.8003uhc_A mol:protein length:146 Globin-1  ali model follow..  21  10....LTADVKKDLRDSWKVIGSDKK------GNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQAFIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLAKNFGDKYANAWAKLVAVVQAAL.... 146
51 -49.8002auo_A mol:protein length:146 Globin I  ali model follow..  21  10....LTADVKKDLRDSWKVIGSDKK------GNGVALMTTLFADNQETIGYFKRLGSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKYAVNHI-TRKISAAEFGKINGPIKKVLAKNFGDKYANAWAKLVAVVQAAL.... 146
52 -49.8003ugy_A mol:protein length:146 Globin-1  ali model follow..  21  10....LTADVKKDLRDSWKVIGSDKK------GNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNYIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLAKNFGDKYANAWAKLVAVVQAAL.... 146
53 -49.8002r4z_A mol:protein length:146 Globin-1  ali model follow..  21  10....LTADVKKDLRDSWKVWGSDKK------GNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLAKNFGDKYANAWAKLVAVVQAAL.... 146
54 -49.7003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  17  10....FTEEQEALVVKAWAVMKKNSA------ELGLQFFLKIFEIAPSAKNLFSYLKVPLEQNPKLKPHATTVFVMTCESAVQLRKAGVKESDLKRIGAIHFK-TGVVNEHFEVTRFALLETIKEAVPPEMKNAWGVAYDQLVAAIKFEM 157
55 -49.7001it2_A mol:protein length:146 hemoglobin  ali model follow..  17  11....LTDGDKKAINKIWPKIYKEYE------QYSLNILLRFLKCFPQAQASFPKFSSNLEQDPEVKHQAVVIFNKVNEIINSMDNQEEIIKSLKDLSQKHKTVFKVDSIWFKELSSIFVSTIDGGA------EFEKLFSIICILLRSA. 145
56 -49.4003bj1_A mol:protein length:142 hemoglobin alpha  ali model follow..  19  1...SLSSKDKDAVKALWGKIADKAE------EIGADALGRMLAVYPQTKTYFSHWKDLSPGSAPVNKHGKTIMGGLVDAVASIDD---LNAGLLALSELHAFTLRVDPANFKILSHCILVQLAVKFPPEVHLSYDKFFSAVARALAEKY 141
57 -49.4002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  20  13....FGEEQEALVLKSWAVMKKDAA------NLGLRFFLKVFEIAPSAKQMFSFLRVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHL-RYGVADGHFEVTGFALLETIKEALSLEMKKAWAEAYSQLVAAIKREM 161
58 -49.3002r1h_A mol:protein length:143 Hemoglobin subunit alpha-4  ali model follow..  17  1..XSLSAKDKANVKAIWGKILPKSD------EIGEQALSRMLVVYPQTKAYFSHWASVAPGSAPVKKHGITIMNQIDDCVGHMDD---LFGFLTKLSELHATKLRVDPTNFKILAHNLIVVIAAYFPPEIHLSVDKFLQQLALALAEKY 142
59 -49.3001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  20  14....FSEEQEALVLKSWAILKKDSA------NIALRFFLKIFEVAPSASQMFSFLRVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHL-KYGVGDAHFEVVKFALLDTIKEEVSPAMKSAWSEAYDHLVAAIKQEM 162
60 -49.3001v4u_A mol:protein length:144 hemoglobin alpha chain  ali model follow..  16  1.XTTLSDKDKSTVKALWGKISKSAD------AIGADALGRMLAVYPQTKTYFSHWPDMSPGSGPVKAHGKKVMGGVALAVSKIDDLTTG---LGDLSELHAFKMRVDPSNFKILSHCILVVVAKMFPPDAHVSLDKFLASVALALAERY 143
61 -49.2003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  18  10....FTEEQEALVVKSWAVMKKNSA------ELGLKFFLKIFEIAPSAKNLFSYLKDPLEQNPKLKPHAMTVFVMTCESAVQLRKAGVRESNLKRLGAIHF-KNGVVNEHFEVTRFALLETIKEAVPPEMKNAWGEAYDQLVAAIKSEM 157
62 -49.2002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  20  10....FSEEKEALVLKSWAIMKKDSA------NLGLRFFLKIFEIAPSARQMFPFLRVPLETNPKLKTHAVSVFVMTCEAAAQLRKAGKITTTLKRLGGTHL-KYGVADGHFEVTRFALLETIKEALGPEMRNAWGEAYDQLVAAIKQEM 158
63 -49.1001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  19  3....LTESQAALVKSSWEEFNANIP------KHTHRFFILVLEIAPAAKDLFSFLKEVPQNNPELQAHAGKVFKLVYEAAIQLEVTGVTDATLKNLGSVHVS-KGVADAHFPVVKEAILKTIKEVVGEELNSAWTIAYDELAIVIKKEM 149
64 -49.1002vyw_A mol:protein length:148 HEMOGLOBIN  ali model follow..  14  1..AVLTQTQIDSILADLAHH---TDTTEHITEMGVSIYKTLFAAHPEYISYFSKLQDNVGQSEGIRYYGRTLGEELIRLLKAASNPSVLEERIVQGAKDHKAR-PVTKDQFTGAAPIFIKFFQGLLKKQDKDAIEKFLLHVMQAIAAKM 148
65 -49.0001hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  16  2....LSAAQRQVIAATWKDIAG----ADNGAGVGKKCLIKFLSAHPQMAAVFGFSGAS---DPGVAALGAKVLAQIGVAVSHLGDEGKMVAQMKAVGVRHKGNKHIKAQYFEPLGASLLSAMEHRIGAAAKDAWAAAYADISGALISGL 145
66 -48.9003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  17  9....FTEEQEALVVKSWSVMKKNSA------ELGLKLFIKIFEIAPTTKKMFSFLRDPAEQNPKLKPHAMSVFVMCCESAVQLRKTGVRETTLKRLGASHS-KYGVVDEHFEVAKYALLETIKEAVPPEMKVAWGQAYDHLVAAIKAEM 156
67 -48.8001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  19  13....LTLAQKKIVRKTWHQLMRNKT------SFVTDVFIRIFAYDPSAQNKFPQMAGQLRSSRQMQAHAIRVSSIMSEYVEELDS-DILPELLATLARTHD-LNKVGADHYNLFAKVLMEALQAELGEKTRDAWAKAFSVVQAVLLVKH 157
68 -48.8004jac_A mol:protein length:138 Dehaloperoxidase A  ali model follow..  14  2...........GFKQDIATIRGDLR------TYAQDIFLAFLNKYPDERRYFKNYVQELKSMAKFGDHSEKVFNLMMEVADRATDCVPLASDANTLVQMKQHS-SLTTGNFEKLFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAG 136
69 -48.7002c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  15  1....MNSEEVNDIKRTWEVVAAKMT------EAGVEMLKRYFKKYPHNLNHFPWFKDDLPENARFKTHGTRILRQVDEGVKALSGDKKFDDVWKKLAQTHH-EKKVERRSYNELKDIIIEVVCSCVKEKQVHAYHKFFDRAYDIAFAEM 147
70 -48.7001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  15  2....LSAAQRQVVASTWKDIAGSDNGA----GVGKECFTKFLSAHHDMAAVFGFSGAS---DPGVADLGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGNKHIKAEYFEPLGASLLSAMEHRIGGAAKDAWAAAYADISGALISGL 145
71 -48.6005oja_A mol:protein length:163 Myoglobin  ali model follow..  19  2...VLSEGEWQLVLHVWAKVEADVA------GHGQDILIRLFKSHPEILEKFDDLKAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFFSEAIIHVLHSRHPADAQGAMNKALELFRKDIAAKY 147
72 -48.6005v5r_B mol:protein length:137 Dehaloperoxidase A  ali model follow..  15  2............FKQDIATLRGDLR------TYAQDIFLAFLNKYPDERRYFKNYVQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHS-SLTTGNFEKLFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAG 135
73 -48.5002qfn_A mol:protein length:138 Dehaloperoxidase A  ali model follow..  14  2...........GFKQDIATIRGDLR------TYAQDIFLAFLNKYPDERRYFKNYVQELKSMAKFGDHTEKVFNLMMEVADRATDSVPLASDANTLVQMKQHS-SLTTGNFEKLFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAG 136
74 -48.5001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  17  13....LTPAEKDLIRSTWDQLMTHRT------GFVADVFIRIFHNDPTAQRKFPQMAGELRTSRQMHAHAIRVSALMTTYIDEMDT-EVLPELLATLTRTHDK-NHVGKKNYDLFGKVLMEAIKAELGKQVHDAWAKTFAIVQGVLITKH 157
75 -48.5003mvc_A mol:protein length:161 Globin protein 6  ali model follow..  12  3....LTQPQILFVRKTWNHARNQGAL-----EPAISIFRNSFFKNPEIRQMIMFGT-KNEGHERLKKHAQLFTVLMDDLIANLDSPSATVAGLREAGEKHVWPCPFHAHLLDQFATAMIERTKKDRTETTQRGWTKIVLFVTEQLKEGF 152

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.