current user: public

If you have questions about the server, please let us know.

Query: d2itka2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
1 -81.4002ruc_A mol:protein length:117 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  100  5EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 117
2 -79.7003i6c_A mol:protein length:123 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  98  11EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 123
3 -77.7004tns_A mol:protein length:151 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  98  33EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 145
4 -75.7002zqv_A mol:protein length:163 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  100  51EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 163
5 -75.7002lj4_A mol:protein length:115 Peptidyl-prolyl cis-trans isomerase/rotamase, putative  ali model follow..  51  2.SEKLRAAHLLVKFSGSRNPVSRRTGDSTVTYEDAIKELQKWSQRIASGEVSFEEAASQRSDCGSYASGGDLGFFSSGEMMKPFEDAVRALKIGDISPIVQTDSGLHIIKRL. 114
6 -75.7002zqu_A mol:protein length:163 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  100  51EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 163
7 -75.4002zr4_A mol:protein length:163 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  100  51EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 163
8 -75.4002zqt_A mol:protein length:163 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  99  51EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQAQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 163
9 -75.3002zr5_A mol:protein length:163 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  99  51EPARVRCSHLLVAHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 163
10 -75.0002zqs_A mol:protein length:163 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  99  51EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDASSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 163
11 -74.6004qib_A mol:protein length:159 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  100  47EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 159
12 -74.2002f21_A mol:protein length:162 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  100  50EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 162
13 -73.7004u84_A mol:protein length:181 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  100  61EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 173
20 -57.3001zk6_A mol:protein length:93 Foldase protein prsA  ali model follow..  46  2.SGKIRASHILV---------------------ADKKTAEEVEKKLKKG-EKFEDLAKEYSTDSSASKGGDLGWFAKGQMDETFSKAAFKLKTGEVSDPVKTQYGYHIIKKTE 92
21 -56.9002m1i_A mol:protein length:97 Parvulin-like peptidyl-prolyl isomerase  ali model follow..  43  6MADKIKCSHILV---------------------KKQGEALAVQERLKAG-EKFGKLAKELSDGGSAKRDGSLGYFGRGKMVKPFEDAAFRLQVGEVSEPVKSEFGYHVIKRL. 96
22 -55.9002m08_A mol:protein length:93 PpiC-type peptidyl-prolyl cis-trans isomerase  ali model follow..  45  2PSNKIKCSHILV---------------------SKQSEALAIMEKLKSG-EKFGKLAKELSIDSSAKKNGNLGYFTKGMMVKPFEDAAFKLQVGEVSEPIKSEFGYHIIKRF. 92
23 -53.3003gpk_A mol:protein length:112 PpiC-type peptidyl-prolyl cis-trans isomerase  ali model follow..  21  4GTEEYRIGEIFLAATEE-------------NKPQVFANAEKIVEQLKQG-GSFVAYARQYSEASTAAVGGDLGWIRLAQLPTELATTAASMGPGQLAGPVEIRGGFSILYLID 102
25 -52.4003ui4_A mol:protein length:101 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4  ali model follow..  35  4GSNAVKVRHILC---------------------EKHGKIMEAMEKLKSG-MRFNEVAAQYSEDKA-RQGGDLGWMTRGSMVGPFQEAAFALPVSGMDPPVKTKFGYHIIMVEG 99
26 -50.7002kgj_A mol:protein length:102 Peptidyl-prolyl cis-trans isomerase D  ali model follow..  24  2QPQRTRYSIIQTK---------------------TEDEAKAVLDELNKG-GDFAALAKEKSADISARNGGDMGWLEDATIPDELKNAGL-KEKGQLSGVIKSSVGFLIVRLDD 92
27 -46.9004wo7_A mol:protein length:263 Foldase protein PrsA  ali model follow..  45  116LKGKIRASHILV---------------------ADKKTAEEVEKKLKKG-EKFEDLAKEYSTDSSASKGGDLGWFAKGQMDETFSKAAFKLKTGEVSDPVKTQYGYHIIKKTE 207
28 -45.3005ez1_A mol:protein length:277 Putative peptidyl-prolyl cis-trans isomerase HP_0175  ali model follow..  33  123VKQEAHARHILVK-----------------TEDEAKRIISEIKQPKAKKEAKFIELANRDTIDPNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKPVKTEFGYHIIYLIS 223
29 -44.6003rfw_A mol:protein length:252 Cell-binding factor 2  ali model follow..  40  109KPARVQAKHILVA-----------------TEKEAKDIINELKGKGKELDAKFSELAKEKSIDPSKNQGGELGWFDQSTMVKPFTDAAFALKNGTITTPVKTNFGYHVILKEN 207
30 -44.0005htf_A mol:protein length:283 Foldase protein PrsA 1  ali model follow..  30  115WEPDITVRHILV---------------------DDEATAKEIQTKLKNG-EKFTDLAKEYSDTATSTNGGLLDPFGPGEMDETFEKAAYALEKDDVSGIVKSTYGYHLIQLVK 207
31 -43.7006bhf_A mol:protein length:299 Putative peptidyl-prolyl cis-trans isomerase HP_0175  ali model follow..  33  153VKQEAHARHILVK-----------------TEDEAKRIISEIKQPKAKKEAKFIELANRDTIDPNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKPVKTEFGYHIIYLIS 253
33 -41.2005tvl_A mol:protein length:287 Foldase protein PrsA  ali model follow..  18  117.TPDVTAQIIRL---------------------NNEDKAKEVLEKAKAEGADFAQLAKDNSTDETKENGGEITFDSASTEVPEVKKAAFALDVDGVSDVITASSQYYIVKLTK 215
36 -15.2003rgc_A mol:protein length:252 Possible periplasmic protein  ali model follow..  10  132FYTQINANIYLSN-------------------------NPQTLENIKNTK-KTILKPQNASLNTSNADPR-------------LLGLLSQIPVGSFSPVLNGKNGYELYEVKS 205

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.