current user: public

If you have questions about the server, please let us know.

Query: d2mnta_ d.26.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]}, from SCOP207

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst PTERHFYHVLVKHKDVRRPSSLAPRNKGEKITRSRADAINLAQAILAQHKERKTWSLDEFVQVVRDFSECGSAKRDGDLGMVESGTYTEGFDTVAFSLKSGEVSAPVETELGVHLIYRVELast
1 -83.4002mnt_A mol:protein length:120 TbPar42  ali model follow..  100  1PTERHFYHVLVKHKDVRRPSSLAPRNKGEKITRSRADAINLAQAILAQHKERKTWSLDEFVQVVRDFSECGSAKRDGDLGMVESGTYTEGFDTVAFSLKSGEVSAPVETELGVHLIYRVE 120
2 -68.9003i6c_A mol:protein length:123 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  34  12PARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKS--------GEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 123
3 -68.8002ruc_A mol:protein length:117 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  34  6PARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKS--------GEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 117
4 -68.7002zr5_A mol:protein length:163 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  32  52PARVRCSHLLVAHSQSRRPSSWRQEKITRTKEEALELI--------NGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 163
5 -68.5004tns_A mol:protein length:151 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  34  34PARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKS--------GEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 145
6 -68.3002zqv_A mol:protein length:163 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  40  52PARVRCSHLLVKHSQSRRPSSWRQ----EKITRTKEEALELINGYIQKIK----SGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 163
7 -68.1002lj4_A mol:protein length:115 Peptidyl-prolyl cis-trans isomerase/rotamase, putative  ali model follow..  29  2SEKLRAAHLLVKFSGSRNPVSRRTGDSTADVTYEDAI------KELQKWSQRIASGEVSFEEAASQRSDCGSYASGGDLGFFSSGEMMKPFEDAVRALKIGDISPIVQTDSGLHIIKRL. 114
8 -67.1002zqu_A mol:protein length:163 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  40  52PARVRCSHLLVKHSQSRRPSSWRQ----EKITRTKEEALELINGYIQKIK----SGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 163
9 -67.0002zr4_A mol:protein length:163 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  40  52PARVRCSHLLVKHSQSRRPSSWRQ----EKITRTKEEALELINGYIQKIK----SGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 163
10 -66.9002zqt_A mol:protein length:163 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  34  52PARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKS--------GEEDFESLASQFSDCSSAKARGDLGAFSRGQAQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 163
11 -66.6001j6y_A mol:protein length:139 peptidyl-prolyl cis-trans isomerase  ali model follow..  31  18RDQVKASHILIKHQGSRRKASWKDPEGKIILTTTREAAVEQLKSIREDIV----SGKANFEEVATRVSDCSSAKRGGDLGSFGRGQMQKPFEEATYALKVGDISDIVDTDSGVHIIKRT. 132
12 -66.4002zqs_A mol:protein length:163 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  39  52PARVRCSHLLVKHSQSRRPSSWRQ----EKITRTKEEALELINGYIQKIK----SGEEDFESLASQFSDASSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 163
13 -66.2004qib_A mol:protein length:159 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  40  48PARVRCSHLLVKHSQSRRPSSWRQ----EKITRTKEEALELINGYIQKIK----SGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 159
14 -65.9002f21_A mol:protein length:162 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  40  51PARVRCSHLLVKHSQSRRPSSWRQ----EKITRTKEEALELINGYIQKIK----SGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 162
15 -65.7004u84_A mol:protein length:181 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1  ali model follow..  34  62PARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKS--------GEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 173
16 -63.9001yw5_A mol:protein length:177 peptidyl prolyl cis/trans isomerase  ali model follow..  30  65DGQVRVSHLLIKNNQSRKPKSWKSPDG---ISRTRDESIQILKKHLERIL----SGEVKLSELANTESDCSSHDRGGDLGFFSKGQMQPPFEEAAFNLHVGEVSNIIETNSGVHILQRT. 176
17 -62.1002jzv_A mol:protein length:111 Foldase protein prsA  ali model follow..  26  5SDSKKASHILIKVKSKKSDKEGLDDKE--------------AKQKAEEIQKEVSKDPSKFGEIAKKESMDTSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADK 111
18 -62.1001jns_A mol:protein length:92 PEPTIDYL-PROLYL CIS-TRANS ISOMERASE C  ali model follow..  29  2...............................KTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLY 90
19 -60.1001zk6_A mol:protein length:93 Foldase protein prsA  ali model follow..  36  2SGKIRASHILVADKKT------------------------------AEEVEKKLKKGEKFEDLAKEYSTDSSASKGGDLGWFAKGQMDETFSKAAFKLKTGEVSDPVKTQYGYHIIKKTE 92
20 -58.9002m1i_A mol:protein length:97 Parvulin-like peptidyl-prolyl isomerase  ali model follow..  35  7ADKIKCSHILVKKQGE------------------------------ALAVQERLKAGEKFGKLAKELSDGGSAKRDGSLGYFGRGKMVKPFEDAAFRLQVGEVSEPVKSEFGYHVIKRL. 96
21 -58.1002m08_A mol:protein length:93 PpiC-type peptidyl-prolyl cis-trans isomerase  ali model follow..  32  3SNKIKCSHILVSKQSE------------------------------ALAIMEKLKSGEKFGKLAKELSIDSSAKKNGNLGYFTKGMMVKPFEDAAFKLQVGEVSEPIKSEFGYHIIKRF. 92
22 -56.6003gpk_A mol:protein length:112 PpiC-type peptidyl-prolyl cis-trans isomerase  ali model follow..  22  5TEEYRIGEIFLAATEENKP----------------------QVFANAEKIVEQLKQGGSFVAYARQYSEASTAAVGGDLGWIRLAQLPTELATTAASMGPGQLAGPVEIRGGFSILYLID 102
23 -55.6001fjd_A mol:protein length:104 PEPTIDYL PROLYL CIS/TRANS ISOMERASE (PPIASE)  ali model follow..  22  1.......................GSGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKA-RQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVKTKFGYHIIMVEG 102
24 -54.8004g2p_A mol:protein length:110 Chaperone SurA  ali model follow..  26  6VTEVHARHILLKPSPIMNDQQ--------------------ARLKLEEIAADIKSGKTTFAAAAKEYSQDPSANQGGDLGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLD 106
25 -54.6003ui4_A mol:protein length:101 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4  ali model follow..  24  5SNAVKVRHILCE------------------------------KHGKIMEAMEKLKSGMRFNEVAAQYSEDKA-RQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVKTKFGYHIIMVEG 99
26 -53.3002kgj_A mol:protein length:102 Peptidyl-prolyl cis-trans isomerase D  ali model follow..  17  3PQRTRYSIIQTKTEDE------------------------------AKAVLDELNKGGDFAALAKEKSADISARNGGDMGWLEDATIPDELKNAGL-KEKGQLSGVIKSSVGFLIVRLDD 92
27 -50.8004wo7_A mol:protein length:263 Foldase protein PrsA  ali model follow..  36  117KGKIRASHILVADKKT------------------------------AEEVEKKLKKGEKFEDLAKEYSTDSSASKGGDLGWFAKGQMDETFSKAAFKLKTGEVSDPVKTQYGYHIIKKTE 207
28 -49.3005ez1_A mol:protein length:277 Putative peptidyl-prolyl cis-trans isomerase HP_0175  ali model follow..  28  124KQEAHARHILVKTEDEAKRI------------------------ISEIDKQPKAKKEAKFIELANRDTIDPNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKPVKTEFGYHIIYLIS 223
29 -47.9003rfw_A mol:protein length:252 Cell-binding factor 2  ali model follow..  24  110PARVQAKHILVATEKEAKDI------------------------INELKGLKGKELDAKFSELAKEKSIDPSKNQGGELGWFDQSTMVKPFTDAAFALKNGTITTPVKTNFGYHVILKEN 207
30 -47.7005htf_A mol:protein length:283 Foldase protein PrsA 1  ali model follow..  23  116EPDITVRHILVDDEAT------------------------------AKEIQTKLKNGEKFTDLAKEYSDTATSTNGGLLDPFGPGEMDETFEKAAYALEKDDVSGIVKSTYGYHLIQLVK 207
31 -47.6006bhf_A mol:protein length:299 Putative peptidyl-prolyl cis-trans isomerase HP_0175  ali model follow..  28  154KQEAHARHILVKTEDEAKRI------------------------ISEIDKQPKAKKEAKFIELANRDTIDPNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKPVKTEFGYHIIYLIS 253
32 -41.8002pv3_A mol:protein length:299 Chaperone surA  ali model follow..  15  151STELNLSHILIPLPENPTSDQVNEAES------------------QARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVND 252
33 -40.0005tvl_A mol:protein length:287 Foldase protein PrsA  ali model follow..  13  117TPDVTAQIIRLNNEDKAK-----------------------------EVLEKAKAEGADFAQLAKDNSTDETKENGGEITFDSASTEVPEVKKAAFALDVDGVSDVITASSQYYIVKLTK 215
34 -35.6001m5y_A mol:protein length:408 Survival protein surA  ali model follow..  15  151STELNLSHILIPLPENPTSDQVNEAES------------------QARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVND 252
35 -35.2003nrk_A mol:protein length:325 LIC12922  ali model follow..  10  159EIRYRIISIAPENDSIQEENR--------------------LYKEVSEIRKSILADPSSFALIAGSPRNDPLRARRGMVEWISSFDLYKITATIAAPLPNGGVSEVFRDERKYCILKIEG 263
36 -18.4003rgc_A mol:protein length:252 Possible periplasmic protein  ali model follow..  10  115............SDDGAKKFFEQNKDKFTFYTQINANIYLSNNPQTLE----NIKNTKKTILKPQNASLNTSNADPR-------------LLGLLSQIPVGSFSPVLNGKNGYELYEVKS 205

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24