current user: public

If you have questions about the server, please let us know.

Query: d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}, from SCOP207

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200
# Score Template Links and tools%idFirst MKVEELAESISSYAVGILKEEGIEELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREAIKGGKSLYVVPLRALAGEKYESFKKWEKIGLRIGISTGDYESRDEHLGDCDIIVTTSEKADSLIRNRASWIKAVSCLVVDEIHLLDSEKRGATLEILVTKMRRMNKALRVIGLSATAPNVTEIAEWLDADYYVSDWRLast
1 -76.2002p6r_A mol:protein length:702 afUHEL308 HELICASE  ali model follow..  100  1MKVEELAESISSYAVGILKEEGIEELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREAIKGGKSLYVVPLRALAGEKYESFKKWEKIGLRIGISTGDYESRDEHLGDCDIIVTTSEKADSLIRNRASWIKAVSCLVVDEIHLLDSEKRGATLEILVTKMRRMNKALRVIGLSATAPNVTEIAEWLDADYYVSDWR 202
2 -71.2002va8_A mol:protein length:715 SKI2-TYPE HELICASE  ali model follow..  44  8MPIEDL--KLPSNVIEIIKKRGIKKLNPPQTEAVKKGLEGNRLLLTSPTGSGKTLIAEMGIISFLLKGGKAIYVTPLRALTNEKYLTFKDWELIGFKVAMTSGDYDTDDAWLKNYDIIITTYEKLDSLWRHRPEWLNEVNYFVLDELHYLNDPERGPVVESVTIRAKR----RNLLALSATISNYKQIAKWLGAEPVATNWR 205
3 -71.2002zj2_A mol:protein length:720 Putative ski2-type helicase  ali model follow..  54  1MRVDEL--RVDERIKSTLKERGIESFYPPQAEALKSGIEGKNALISIPTASGKTLIAEIAMVHRILTGGKAVYIVPLKALAEEKFQEFQDWEKIGLRVAMATGDYDSKDEWLGKYDIIIATAEKFDSLLRHGSSWIKDVKILVADEIHLIGSRDRGATLEVILAHML---GKAQIIGLSATIGNPEELAEWLNAELIVSDWR 199
4 -66.5005a9j_A mol:protein length:896 DNA POLYMERASE THETA  ali model follow..  32  76.......WGLPKAVLEKYHSFGVKKMFEWQAECLLLVLEGKNLVYSAPTSAGKTLVAELLILKRVLERKKALFILPFVSVAKEKKYYLQSFQEVGIKVDGYMGSTSPS-RHFSSLDIAVCTIERANGLINRLENKMDLLGMVVVDELHMLGDSHRGYLLELLLTKICYITRAVQIVGMSATLPNLELVASWLNAELYHTDFR 290
5 -58.4003jcr_C mol:protein length:2136 hBrr2  ali model follow..  36  462LPVEKLPKYAQAGF------EGFKTLNRIQSKLYRAALTDENLLLCAPTGAGKTNVALMCMLREIGKDFKIIYIAPMRSLVQEMVGSFKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGEYTQLVRLIILDEIHLLHDD-RGPVLEALVARAIRNQEDVRLIGLSATLPNYEDVATFLRVDYFDNSFR 681
6 -57.0005m59_A mol:protein length:1772 Pre-mRNA splicing helicase-like protein  ali model follow..  27  953....................PNWQQFNKIQTQTFNSLYTDNNVLVAAPTGSGKTVCAEFALLRHWAKAGRAVYIAPFQELVDLRFQDWQK--RGGKEIVKLTGETTTDLKLLEQGDLILATPLQWDVLSRQWKRNVQTVELFIADDLHMLGGQ-MGYIYEIVVSRMHFIELPMRIVGLSVSLANARDIGEWIDAKNFSPHVR 1150
7 -55.3005dca_A mol:protein length:1948 Pre-mRNA-splicing helicase BRR2  ali model follow..  29  278.......TSLPDWCQEAFPSSETTSLNPIQSKVFHAAFGDSNMLICAPTGSGKTNIALLTVLKALSHAFKIVYIAPLKALVQEQVREFRRLAFLGIKVAELTGDSRLSRKQIDETQVLVSTPEKWDITTRNSNNIVELVRLLIIDEIHLLHDD-RGPVLESIVARTFWAQEYPRIIGLSATLPNYEDVGRFLRVPYFDSSFR 496
8 -55.1003jcm_N mol:protein length:2163 Pre-mRNA-splicing helicase BRR2  ali model follow..  18 1344.....................EFKTFNKIQSQVFESLYSNDSVFVGSGKGTGKTAMAELALLNHWRQNKRAVYINPSGEKIDFLLSDWKRFSHLAKIINKLGNDPSLNLKLLAKSHVLLATPVQFELLSRRWRQNIQSLELMIYDDAHEISQGVYGAVYETLISRMIFIEKKIRFVCLSNCLANARDFGEWAGMTNFSPSER 1540
9 -44.6006c90_A mol:protein length:734 Exosome RNA helicase MTR4,Exosome RNA helicase MTR4  ali model follow..  27  72........................ILDAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEFQDVGL----MTGDVTIN----PTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILL---PDNVHYVFLSATIPNARQFAEWICCHVIYTDYR 245
10 -35.7005v9x_A mol:protein length:877 ATP-dependent DNA helicase  ali model follow..  25  17...ADPLGRFSALTREWFTT-AFAAPTPAQADAWSAISEGNNTLVIAPTGSGKTLAAFLWAIDRLADPAQVLYVSPLKALAVDVERNLRTLPAPSITVGVRSGDTPPNQRR-NPPDVLITTPESLFLMLSAARETLTSVRTVIVDEVHAVAATKRGAHLALSLERLDQLDTPAQRIGLSATVRPPEEVARFL.......... 229
11 -34.9002xgj_A mol:protein length:1010 ATP-DEPENDENT RNA HELICASE DOB1  ali model follow..  28  80........................TLDPFQDTAISCIDRGESVLVSAHTSAGKTVVAEYAIAQSLKNKQRVIYTSPIKALSNQKYRELAEFGDVGL----MTGDITIN----PDAGCLVMTTEILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVWEETIILL---PDKVRYVFLSATIPNAMEFAEWICCHIVYTNFR 253
12 -33.7006d6q_M mol:protein length:1045 Exosome RNA helicase MTR4  ali model follow..  27  142........................ILDAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMEEFQDVGL----MTGDVTIN----PTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILL---PDNVHYVFLSATIPNARQFAEWICCHVIYTDYR 315
13 -33.6004qu4_A mol:protein length:1108 ATP-dependent RNA helicase DOB1  ali model follow..  28  178........................TLDPFQDTAISCIDRGESVLVSAHTSAGKTVVAEYAIAQSLKNKQRVIYTSPIKALSNQKYRELAEFGDVGL----MTGDITIN----PDAGCLVMTTEILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVWEETIILL---PDKVRYVFLSATIPNAMEFAEWICCHIVYTNFR 351
14 -33.3005mc6_h mol:protein length:1287 Antiviral helicase SKI2  ali model follow..  30  329........................ELDTFQKEAVYHLEQGDSVFVAAHTSAGKTVVAEYAIAMAHRNMTKTIYTSPIKALSNQKFRDFKE----DVNIGLITGDVQIN----PDANCLIMTTEILRSMLYRGADLIRDVEFVIFDEVHYVNDQDRGVVWEEVIIML---PQHVKFILLSATVPNTYEFANWIGIYVISTPKR 504
15 -33.2005e02_A mol:protein length:1106 FRQ-interacting RNA helicase  ali model follow..  29  180........................KLDPFQALSVASIEREESVLVSAHTSAGKTVVAEYAIAQCLKKNQRVIYTSPIKALSNQKYRDFAEFGDVGL----MTGDVTIN----PTASCLVMTTEILRSMLYRGSEIMREVAWVVFDEIHYMRDKIRGVVWEETIILL---PDKVRYVFLSATIPNAFQFAEWIACHVVYTDFR 353
16 -32.5003b6e_A mol:protein length:216 Interferon-induced helicase C domain-containing protein 1  ali model follow..  24  33........................QLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKPGKVIVLVNKVLLVEQLFRKEFQFLKKWYRVIGLSGDTQLKPEVVKSCDIIISTAQILENSLLNLENQLSDFSLIIIDECHHTNKEAVYNNINRLKKENKPVIPLPQILGLTAS..................... 216
17 -32.5002oxc_A mol:protein length:230 Probable ATP-dependent RNA helicase DDX20  ali model follow..  19  30........LLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLNLSTQILILAPTREIAVQIHSVITAIGIKGLECHVFIGPLSQDKTRLKKCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKL---EEGSFQEQINWIYSSLPASKQMLAVSATYPE.................. 210
18 -30.3005jaj_A mol:protein length:681 LGP2  ali model follow..  23  9........................ELHGYQLEAVAPALRGRNSIVWLPTGAGKTRAAVHVCRRHLERGGRVAVLVNKVHLVQQHLEKEFHVLRDAFKVTAVSGDSSHKGQLAKGSDVVICTAQILQNALLSGEEELTDFSLLVIDECHHTQKEAVYNKISYLQKKLSGQRDLPQILGLTASVEHILQICANLDTEVIAS... 206
19 -30.2003tbk_A mol:protein length:555 RIG-I Helicase Domain  ali model follow..  19  7...........................NYQLELALPAKKGKNTIICAPTGCGKTFVSLLICEHHLKQKGKVVFFANQIPVYEQQATVFSRFERLGYNIASISGATSDSQHIIEDNDIIILTPQ-VNNLNNGAIPSLSVFTLMIFDECHTSKNHPYNQIMFRYLDHKLGESRD-QVVGLTASMQHICKLCAALDASVIAT... 203
20 -29.4004on9_A mol:protein length:580 Probable ATP-dependent RNA helicase DDX58  ali model follow..  18  26...........................NYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKQKGKVVFFANQIPVYEQQKSVFSKYFERHGRVTGISGATAENEQIVENNDIIILTPQ-VNNLKKGTIPSLSIFTLMIFDECHTSKQHPYNMIMFNYLDQKLGGSSG-QVIGLTASLDYICKLCASLDASVIAT... 222
21 -29.2003dkp_A mol:protein length:245 Probable ATP-dependent RNA helicase DDX52  ali model follow..  25  35........KINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKKGFRALIISPTRELASQIHRELIKISETGFRIHMIHKAAVAAKK--KKFDILVTTPNRLIYLLKQDPPGLASVEWLVVDESKLFEDGKTGFRDQLASIFLACTSHKVRRAMFSATFAY.................. 222
22 -28.6004bpb_A mol:protein length:698 PROBABLE ATP-DEPENDENT RNA HELICASE DDX58  ali model follow..  18  16...........................NYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKQKGKVVFFANQIPVYEQNKSVFSKYFERHGRVTGISGATAENEQIVENNDIIILTPQ-VNNLKKGTIPSLSIFTLMIFDECHTSKQHPYNMIMFNYLDQKLGGSSG-QVIGLTASLDYICKLCASLDASVIAT... 212
23 -28.3001q0u_A mol:protein length:219 BstDEAD  ali model follow..  18  10........PFQPFIIEAIKTLRFYKPTEIQERIIPGALRGESMVGQSQTGTGKTHAYLLPIMEKIKPERQAVITAPTRELATQIYHETLKITKFMIVARCLIGGTDKQKA--VQPHIVIGTPGRINDFIREQALDVHTAHILVVDEADLMLDMGFITDVDQIAARM---PKDLQMLVFSATIPE.................. 193
24 -28.1006gpg_A mol:protein length:714 Probable ATP-dependent RNA helicase DDX58  ali model follow..  18  28...........................NYQLELALPAMKGKNTIICAPTGFGKTFVSLLICEHHLKQKGKVVFFANQIPVYEQQKSVFSKYFERHGRVTGISGATAENEQIVENNDIIILTPQ-VNNLKKGTIPSLSIFTLMIFDECHTSKQHPYNMIMFNYLDQKLGGSSG-QVIGLTASLDYICKLCASLDASVIAT... 224
25 -28.0001wp9_A mol:protein length:494 ATP-dependent RNA helicase, putative  ali model follow..  26  12...........................IYQEVIYAKCKE-TNCLIVLPTGLGKTLIAMMIAEYRLTKGGKVLMLAPTKPLVLQHAESFRRLFNLPPKIVALTGEKSPESKAWARAKVIVATPQTIENDLLAGRISLEDVSLIVFDEAH---RAVGNYAYVFIAREYKRQAKNPLVIGLTASPGSTPE............... 171
26 -27.7003bor_A mol:protein length:237 Human initiation factor 4A-II  ali model follow..  19  30........NLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLFKETQALVLAPTRELAQQIQKVILALGDMGATCHACIGGTNVRNEQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKL---NTSIQVVLLSATMPT.................. 210
27 -27.7002kbe_A mol:protein length:226 ATP-dependent RNA helicase DBP5  ali model follow..  14  28........GLAPELLKGIYAMKFQKPSKIQERALPLLLHNRNMIAQSQSGTGKTAAFSLTMLTRVDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNM---DQQGLGDQCIRVKRFLPKDTQLVLFSATFAD.................. 206
28 -27.7003iuy_A mol:protein length:228 Probable ATP-dependent RNA helicase DDX53  ali model follow..  21  26........QQYPDLLKSIIRVGILKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPIMLVLTPTRELALHVEAECSKYSYKGLKSICIYGGRNRNGQ--KGVDIIIATPGRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVR---PDRQTVMTSATWPTVRQLAL............ 217
29 -27.5001t6n_A mol:protein length:220 Probable ATP-dependent RNA helicase  ali model follow..  17  20........LLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLTGQVSVLVMCHTRELAFQISKEYERFSKYNVKVAVFFGGLSIKKDKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECKMLEQLDMRRDVQEIFRMT---PHEKQVMMFSATLSK.................. 202
30 -27.5002pl3_A mol:protein length:236 Probable ATP-dependent RNA helicase DDX10  ali model follow..  21  31........PLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFLVPVLEALYRLQGVLIISPTRELAYQTFEVLRKVGKHDFSAGLIIGDLKHEAERINNINILVCTPGRLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENL---PKKRQTLLFSATQTK.................. 214
31 -27.3004a2w_A mol:protein length:936 RETINOIC ACID INDUCIBLE PROTEIN I  ali model follow..  18  248........................KARSYQIELAQPAINGKNALICAPTGSGKTFVSILICEHHFQRKAKVVFLATKVPVYEQQKNVFKHHFERQGSVQGISGENFSNEKVIEDSDIIVVTPQ-VNSFEDGTLTSLSIFTLMIFDECHTTGNHPYNVLMTRYLQKFNSASQLPQILGLTASIEHICSLCSYLDIQAIST... 446
32 -27.3004gl2_A mol:protein length:699 Interferon-induced helicase C domain-containing protein 1  ali model follow..  22  7........................QLRPYQMEVAQPALEGKNIIICLPTGCGKTRVAVYIAKDHLDKPGKVIVLVNKVLLVEQLFRKEFQFLKKWYRVIGLSGDTQLKPEVVKSCDIIISTAQ-ENSLLNLENGELSDFSLIIIDECHTNKEAVYNNIMRHYLMQKLKVIPLPQILGLTASEEHILKLCANLDAFTIKT... 220
33 -27.2005jc3_A mol:protein length:701 Melanoma differentiation associated protein-5  ali model follow..  19  7........................TLRDYQMEVAKPALNGENIIICLPTGSGKTRVAVYITKDHLDKQGKVIVLVNKVPLVEQHLRKEFNPFLKHWQVIGLSGDSELKPEVVKRYDVIICTAQILENSLLNA--RLSDFSLIIIDQCHTQKEGVYNNIMRRYLKEKIKNRKQAQILGLTAS..................... 189
34 -27.2003ly5_A mol:protein length:262 ATP-dependent RNA helicase DDX18  ali model follow..  22  46TSFASLCNLVNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLRGVLILSPTRELAMQTFGVLKELMTHVHTYGLIMGGSNRSAEA-NGINIIVATPGRLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLL---PTRRQTMLFSATQTKVEDLAR............ 245
35 -27.2003ber_A mol:protein length:249 Probable ATP-dependent RNA helicase DDX47  ali model follow..  19  43........GVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQALVLTPTRELAFQISEQFEALGSIGVQSAVIVGGIDSMSQSLKKPHIIIATPGRLDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVI---PRDRKTFLFSATMTK.................. 223
36 -27.1005gju_A mol:protein length:205 ATP-dependent RNA helicase DeaD  ali model follow..  20  7........GLKAPILEALNDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAAFSLPLLQNLDPELKILVLAPTRELAVQVAEAMTDFSK-GVNVVALYGGQRYDVQ--QGPQIVVGTPGRLLDHLKRGTLDLSKLSGLVLDEADEMLRMGFIEDVETIMAQI---PEGHQTALFSATMPE.................. 187
37 -26.6001wrb_A mol:protein length:253 DjVLGB  ali model follow..  15  29........KLDPTIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLVCQDLCLILAPTRELAIQILSESQKFSNTPLRSCVVYGGADTHSQI-MGCHLLVATPGRLVDFIEKNKISLEFCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRTLMFSATFPEIQKLAA............ 228
38 -26.3006bu9_A mol:protein length:1724 Dicer-2, isoform A  ali model follow..  16  12...........................GYQLRLVDHLTK-SNGIVYLPTGSGKTFVAILVLKRFSQDGKRALFMCNTVELARQQAMAVRRC--TNFKVGFYVGEQGVDSDEIKKNQVLVGTAQVFLDMVTQTYVALSSLSVVIIDECHHGTGHH----FREFMRLFTIANQT-RVVGLTGVLIKLKELEITYRGNIITVS.. 205
39 -25.9003fe2_A mol:protein length:242 Probable ATP-dependent RNA helicase DDX5  ali model follow..  16  35........NFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFCLVLAPTRELAQQVQQVAAEYCRCRLKSTCIYGGAPKGPQI-RGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIR---PDRQTLMWSATWPK.................. 219
40 -25.6004a4d_A mol:protein length:253 PROBABLE ATP-DEPENDENT RNA HELICASE DDX5  ali model follow..  16  49........NFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFCLVLAPTRELAQQVQQVAAEYCRCRLKSTCIYGGAPKGPQI-RGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIR---PDRQTLMWSATWPK.................. 233
41 -25.5002z0m_A mol:protein length:337 337aa long hypothetical ATP-dependent RNA helicase deaD  ali model follow..  18  1.........MNEKIEQAIREMGFKNFTEVQSKTIPLMLQGKNVVVRAKTGSGKTAAYAIPILELGM---KSLVVTPTRELTRQVASHIRDIGRMDTKVAEVYGPYKAQINRVRNADIVVATPGRLLDLWSKGVIDLSSFEIVIIDEADLMFEMGFIDDIKIILAQT---SNRKITGLFSATIPE.................. 172
42 -25.1003p4y_A mol:protein length:415 reverse gyrase helicase domain  ali model follow..  17  6........NEYEDFRSFFKKKFGKDLTGYQRLWAKRIVQGKSFTMVAPTGVGKTTFGMMTALWLARKGKKSALVFPTVTLVKQTLERLQKLADEKVKIFGFYSSMKKEEKE-DDYHILVFSTQFVSKNREK---SQKRFDFVFVDDVDAVLKASRNIDTLLMMVGI---PEEIIRKAFSTIKQG.................. 183
43 -24.9002vso_A mol:protein length:395 ATP-DEPENDENT RNA HELICASE EIF4A  ali model follow..  21  28........ELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIVKAPQALMLAPTRELALQIQKVVMALAFMDIKVHACIGSFVEDAEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLL---PPTTQVVLLSATMPN.................. 206
44 -24.8005h1y_A mol:protein length:281 Probable ATP-dependent RNA helicase DDX41  ali model follow..  18  52........KFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKGLIICPSRELARQTHGILEYYCRLLLRCALCIGGMSVKEQM-HGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFK---GQRQTLLFSATMPKIQNFAK............ 252
45 -24.4004kbf_A mol:protein length:365 Heat resistant RNA dependent ATPase  ali model follow..  20  1MEFKDF--PLKPEILEALHGRGLTTPTPIQAAALPLALEGKDLIGQARTGTGKTLAFALPIAERLAPSQRALVLTPTRELALQVASELTAVAP-HLKVVAVYGGTGYGKQK-RGADAVVATPGRALDYLRQGVLDLSRVEVAVLDEADEMLSMGFEEEVEALLSAT---PPSRQTLLFSATLPS.................. 187
46 -24.2004ct4_B mol:protein length:378 PROBABLE ATP-DEPENDENT RNA HELICASE DDX6  ali model follow..  21  11........CLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLKDNIQAMVIVPTRELALQVSQICIQVSK-GAKVMATTGGTNLRDD--DTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTL---PKNRQILLYSATFPL.................. 191
47 -24.1002oca_A mol:protein length:510 ATP-dependent DNA helicase uvsW  ali model follow..  21  113........................EPHWYQKDAVFEGLVNRRRILNLPTSAGRSLIQALLARYYLENEGKILIIVPTTALTTQMADDFVDYRLFHAMIKKIGGGASKDDKYKNDAPVVVGTWQ---TVVKQPKEWFSQFGMMMNDECHLATGKSISSIIS-------GLNNCMFKFGLSGSLRDGK................ 266
48 -24.0005zak_A mol:protein length:1922 Endoribonuclease Dicer  ali model follow..  15  46...........................KYQVELLEAALD-HNTIVCLNTGSGKTFIAVLLTKELSYQGKRTVFLVNSANQVAQQVSAVRTHSDL--KVGEYSNLEVNANQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDH----YREIMKLCENCPSCPRILGLTASILNIQKLEKILKSNAETAT.. 238
49 -24.0002fwr_A mol:protein length:472 DNA repair protein RAD25  ali model follow..  26  87........................SLRDYQEKALERWLVDKRGCIVLPTGSGKTHVAMAAINEL---STPTLIVVPTLALAEQWKERLGIF--GEEYVGEFSGRIK------ELKPLTVSTYD---SAYVNAEKLGNRFMLLIFDEVHHLPAESYVQIAQMSIAPFR--------LGLTATFEREDGRHEIL.......... 232
50 -24.0002j0u_A mol:protein length:374 ATP-DEPENDENT RNA HELICASE DDX48  ali model follow..  16  7........GLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSVSVLQCLVRETQALILAPTRELAVQVQKGLLALGDMNVQCHACIGGTNVGED--YGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYL---PPATQVVLISATLPH.................. 186
51 -23.8001s2m_A mol:protein length:400 Putative ATP-dependent RNA helicase DHH1  ali model follow..  21  27........YLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVLNKIQALIMVPTRELALQTSQVVRTLGKCGISCMVTTGGTNLRDD--ETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFL---PPTHQSLLFSATFPL.................. 206
52 -23.8002hyi_C mol:protein length:413 Probable ATP-dependent RNA helicase DDX48  ali model follow..  16  44........GLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLVRETQALILAPTRELAVQIQKGLLALGDMNVQCHACIGGTNVGED--YGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYL---PPATQVVLISATLPH.................. 223
53 -23.8005tnu_A mol:protein length:459 DNA-dependent ATPase XPBII  ali model follow..  29  82........................ELRDYQAEAVKAWLKEKRGIIVLPTGAGKTQVALKIVSIM---KVATLIVVPTIDLITQWKERINKY--LDFDPGIIGGGED------SLKGITVITYD---SAYTRAEELGNKFPLLIFDEVHHLPSEGYSIMAQLFASPYR--------LGLTATPERDDG............... 222
54 -23.7005sup_A mol:protein length:390 ATP-dependent RNA helicase SUB2  ali model follow..  15  12........LLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPAVVVICNARELAYQIRNEYLRFSKYDVKTAVFYGGTPISKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECKVLEELDMRRDVQEIFRAT---PRDKQVMMFSATLSQ.................. 196
55 -23.7003ews_A mol:protein length:445 ATP-dependent RNA helicase DDX19B  ali model follow..  15  62........RLKPQLLQGVYAMGFNRPSKIQENALPLMLAEQNLIAQSQSGTGKTAAFVLAMLSQVNKYPQCLCLSPTYELALQTGKVIEQMGKFELKLAYAVRGNKLERGQKISEQIVIGTPGTLDWCSKLKFIDPKKIKVFVLDEADVM---ATQGHQDQSIRIQRMLPRNCQMLLFSATFED.................. 243
56 -23.3003eiq_A mol:protein length:414 Eukaryotic initiation factor 4A-I  ali model follow..  21  46........NLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQILKATQALVLAPTRELAQQIQKVVMALGDMGASCHACIGGTNVRAEQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKL---NSNTQVVLLSATMPS.................. 226
57 -23.3005suq_A mol:protein length:446 ATP-dependent RNA helicase SUB2  ali model follow..  15  68........LLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLPGEVAVVVICNARELAYQIRNEYLRFSKYDVKTAVFYGGTPISKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECKVLEELDMRRDVQEIFRAT---PRDKQVMMFSATLSQ.................. 252
58 -23.3005z3g_Y mol:protein length:505 ATP-dependent RNA helicase HAS1  ali model follow..  18  48........KLSQPTLKAIEKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIELLHSLKGIIVITPTRELALQIFGVARELMEHSQTFGIVIGGANRRQEA-KGVNMLIATPGRLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKIL---NEDRQSMLFSATQTTVEDLAR............ 240
59 -23.2001xti_A mol:protein length:391 Probable ATP-dependent RNA helicase p47  ali model follow..  17  14........LLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLTGQVSVLVMCHTRELAFQISKEYERFSKYNVKVAVFFGGLSIKKDKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECKMLEQLDMRRDVQEIFRMT---PHEKQVMMFSATLSK.................. 196
60 -23.2003fmp_B mol:protein length:479 ATP-dependent RNA helicase DDX19B  ali model follow..  15  98........RLKPQLLQGVYAMGFNRPSKIQENALPLMLAEQNLIAQSQSGTGKTAAFVLAMLSQVNKYPQCLCLSPTYELALQTGKVIEQMGKFELKLAYAVRGNKLERGQKISEQIVIGTPGTLDWCSKLKFIDPKKIKVFVLDEADVM---ATQGHQDQSIRIQRMLPRNCQMLLFSATFED.................. 279
61 -23.1004d25_A mol:protein length:434 BMVLG PROTEIN  ali model follow..  18  56........NLRKYVLDNVLKAGYRKPTPIQKNAIPIIMSGRDLMGCAQTGSGKTAAFLVPIINMLLQDPKVIIVSPTRELTLQIFNEARKFSGSVLKVAVAYGGTAVRHQG-RGCHILVATPGRLHDFVERNRVSFGSVRFVVLDQADCMLDMGFMPSIEKMMLHPTMETTKRQTLMFSATFPDIQHLAG............ 255
62 -23.1001hv8_A mol:protein length:367 PUTATIVE ATP-DEPENDENT RNA HELICASE MJ0669  ali model follow..  18  12........NLSDNILNAIRNKGFEKPTDIQMKVIPLFLNDENIVAQARTGSGKTASFAIPLIELVNENNEAIILTPTRELAIQVADEIESLKGKNLKIAKIYGAIYPQIKALKNANIVVGTPGRILDHINRGTLNLKNVKYFILDEADEMLNMGFIKDVEKILNAC---NKDKRILLFSATMPR.................. 190
63 -22.9002db3_A mol:protein length:434 ATP-dependent RNA helicase vasa  ali model follow..  18  62........DLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHVVIVSPTRELAIQIFNEARKFAESYLKIGIVYGGTSFRHQN-RGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHV--MRPEHQTLMFSATFPEIQRMAG............ 255
64 -22.8005ivl_B mol:protein length:429 DEAD-box ATP-dependent RNA helicase CshA  ali model follow..  20  8........GLSQEVMKAIERMGFEETTPIQAKTIPLSLQNKDVIGQAQTGTGKTAAFGIPIVEKVDVKNQALVVAPTRELAIQVSEELYKIGAKRVRVLPIYGGQDIERQ--KHPHVIVGTPGRIIDHINRGTLRLEHVHTVVLDEADEMLNMGFIEDIEAILSHV---PAERQTLLFSATMPD.................. 187
65 -22.0003pew_A mol:protein length:395 ATP-dependent RNA helicase DBP5  ali model follow..  14  11........GLAPELLKGIYAMKFQKPSKIQERALPLLLHNRNMIAQSQSGTGKTAAFSLTMLTRVDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNM---DQQGLGDQCIRVKRFLPKDTQLVLFSATFAD.................. 189
66 -22.0005dtu_A mol:protein length:475 Prp28  ali model follow..  18  48........GLPRRLLDIVYRVGYDEPTPIQRAAIPIALQARDLIGVAVTGSGKTAAFLLPLLVYISELPPALILAPTRELVQQIESEARKFADLGFTVVSIVGGHSLEEQA-NGAEIIVATPGRLVDCIERRLLVFSQCCYVIMDEADRMIDQGFEEPLTKILDALPVSNEK-QTMMYTATMPTVEKIAK............ 267
67 -21.5003i5x_A mol:protein length:563 ATP-dependent RNA helicase MSS116  ali model follow..  18  78........VLDKEIHKAITRMEFPGLTPVQQKTIKPILEDHDVIARAKTGTGKTFAFLIPIFQHLINTKKAVIVAPTRDLALQIEAEVKKIHDMKYACVSLVGGTDFRAAM-LRPNIVIATPGRLDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILSKSADNIKTLLFSATLDKVQKLAN............ 283
68 -21.4004pxa_A mol:protein length:467 ATP-dependent RNA helicase DDX3X  ali model follow..  18  65........EMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPSLVLAPTRELAVQIYEEARKFSRSRVRPCVVYGGADIGQQI-RGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLVMGFEPQIRRIVEQDTMPKGVRHTMMFSATFPEIQMLAR............ 273
69 -21.1004nho_A mol:protein length:488 Probable ATP-dependent RNA helicase DDX23  ali model follow..  20  65........SLPPHILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKAIILAPTRELAQQIEEETIKFGKLGIRTVAVIGGISREDQG-MGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQK-QTVMFTATMPAVERLAR............ 286
70 -21.0006cz5_A mol:protein length:480 ATP-dependent RNA helicase DDX3X  ali model follow..  18  59........EMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGCGKTAAFLLPILSQIYSDGPSLVLAPTRELAVQIYEEARKFSRSRVRPCVVYGGADIGQQI-RGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPKGVRHTMMFSATFPEIQMLAR............ 267
71 -20.8005lst_A mol:protein length:693 ATP-dependent DNA helicase Q4  ali model follow..  21  43..........PAEVFQALEQLGHQAFRPGQERAVMRILSGISTLLVLPTGAGKSLCYQLALLYSRRSPCLTLVVSPLLSLMDDQVSGLPP----CLKAACIHSGMTRKQRE-AQVHVLMLTPEALVG-GLPPAAQLPPVAFACIDEAHCLSQWSHNPCYLRVCKVLRERMGVHCFLGLTATATRASDVAQHLAVA....... 236
72 -20.6003sqw_A mol:protein length:579 ATP-dependent RNA helicase MSS116, mitochondrial  ali model follow..  18  27........VLDKEIHKAITRMEFPGLTPVQQKTIKPILEDHDVIARAKTGTGKTFAFLIPIFQHLINTKKAVIVAPTRDLALQIEAEVKKIHDMKYACVSLVGGTDFRAAM-LRPNIVIATPGRLDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILSKSADNIKTLLFSATLDKVQKLAN............ 232
73 -20.4004ljy_A mol:protein length:493 Pre-mRNA-processing ATP-dependent RNA helicase PRP5  ali model follow..  21  59..........TDTMVLITEKLHFGSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRPGLILAPTRELALQIHEEVTKFTETSIRSVCCTGGSEMKKQ--RGTEIVVATPGRFIDILTLNDGKTKRITFVVMDEADRLFDLGFEPQITQIMKTVR---PDKQCVLFSATFPKLRSFAV............ 253
74 -19.9001oyw_A mol:protein length:523 ATP-dependent DNA helicase  ali model follow..  20  22.....................GYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPAL---LLNGLTVVVSPLISLMKDQVDQLQA---NGVAAACLNSTQTREQQL-GQIRLLYIAPERLMLDNFLEHLAHWNPVLLAVDEAHCISQWGHDFRPEYALGQLRQRFPTLPFMALTATADDTQDIVRLLGLN....... 199
75 -19.9004q47_A mol:protein length:525 DNA helicase RecQ  ali model follow..  21  21.....................GYPAFRGVQGEIVQQVAEGGNALVLMPTGGGKSLCYQLPSL---LRPGTGIVVSPLIALMKDQVDTLRQ---NGVRAAFLNSTLLPHEAR-GDLDLLYVAPERLLMPRTLDLLERAPVALFAIDEAHCVSQWGHDFRPEYQLSVLAERFPELPRVALTATADERADIKSVLRLE....... 198

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.