current user: public

If you have questions about the server, please let us know.

Query: d3ci3a1 a.25.2.0 (A:2-188) automated matches {Lactobacillus reuteri [TaxId: 1598]}, from SCOP207

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst KIYTKNGDKGQTRIIGKQILYKNDPRVAAYGEVDELNSWVGYTKSLINSHTQVLSNELEEIQQLLFDCGHDLATPADDERHSFKFKQEQPTVWLEEKIDNYTQVVPAVKKFILPGGTQLASALHVARTITRRAERQIVQLMREEQINQDVLIFINRLSDYFFAAARYANYLEQQPDMLYRNSKDVFRLast
1 -97.9002r6x_A mol:protein length:194 Cobalamin adenosyltransferase PduO-like protein  ali model follow..  99  8KIYTKNGDKGQTRIIGKQILYKNDPRVAAYGEVNELNSWVGYTKSLINSHTQVLSNELEEIQQLLFDCGHDLATPADDERHSFKFKQEQPTVWLEEKIDNYTQVVPAVKKFILPGGTQLASALHVARTITRRAERQIVQLMREEQINQDVLIFINRLSDYFFAAARYANYLEQQPDMLYRNSKDVFR 194
2 -97.4003gah_A mol:protein length:194 Cobalamin adenosyltransferase PduO-like protein  ali model follow..  99  8KIYTKNGDKGQTRIIGKQILYKNDPRVAAYGEVDELNSWVGYTKSLINSHTQVLSNELEEIQQLLFDCGHDLATPADDERHSFKFKQEQPTVWLEEKIDNYTQVVPAVKKHILPGGTQLASALHVARTITRRAERQIVQLMREEQINQDVLIFINRLSDYFFAAARYANYLEQQPDMLYRNSKDVFR 194
3 -97.1002r6t_A mol:protein length:194 Cobalamin adenosyltransferase PduO-like protein  ali model follow..  99  8KIYTKNGDKGQTRIIGKQILYKNDPRVAAYGEVDELNSWVGYTKSLINSHTQVLSNELEEIQQLLFDCGHDLATPADDERHSFKFKQEQPTVWLEEKIDNYTQVVPAVKKFILPGGTQLASALHVARTITKRAERQIVQLMREEQINQDVLIFINRLSDYFFAAARYANYLEQQPDMLYRNSKDVFR 194
4 -94.6002idx_A mol:protein length:196 Cob(I)yrinic acid a,c-diamide adenosyltransferase  ali model follow..  37  3KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAE 192
5 -93.2002nt8_A mol:protein length:223 Cobalamin adenosyltransferase  ali model follow..  100  31KIYTKNGDKGQTRIIGKQILYKNDPRVAAYGEVDELNSWVGYTKSLINSHTQVLSNELEEIQQLLFDCGHDLATPADDERHSFKFKQEQPTVWLEEKIDNYTQVVPAVKKFILPGGTQLASALHVARTITRRAERQIVQLMREEQINQDVLIFINRLSDYFFAAARYANYLEQQPDMLYRNSKDVFR 217
6 -91.5002zhy_A mol:protein length:183 ATP:cob(I)alamin adenosyltransferase, putative  ali model follow..  36  7KIATRTGDDGTTGLGDGSRVRKDDARIAAIGDVDELNSQIGVLLAEPL--PDDVRAALSAIQHDLFDLGGELCIPGHA------AITDAHLARLDGWLAHYNGQLPPLEEFILPGGARGAALAHVCRTVCRRAERSIVALGASEPLNAAPRRYVNRLSDLLFVLARVLNRAAGGADVLWDRTRA... 182
7 -91.1005vl4_A mol:protein length:185 T33-53H-B  ali model follow..  29  1.MFTRRGDQGETDLANRARVGKDSPVVEVQGTIDELNSFIGYALVLSR--WDDIRNDLFRIQNDLFVLGEDVSTGGKGRT-----VTLEMILYLVERVTEMKAEIGKIELFVVPGGSVESASLHMARAVSRRLERRIKAASRLTEINDNVLLYAAMLSSILFMHALISNKRLNIPEKIWSIHRVSLE 179
8 -91.0005cy5_B mol:protein length:185 T33-51H-B  ali model follow..  28  1.MFTRRGDQGETDLANRARVGKDSPVVEVQGTIDELNSFIGYALVLSR--WDDIRNDLFRIQNDLFVLGEDVSTGGKGRT-----VTMDMIIYLIKRSVEMKAEIGKIELFVVPGGSVESASLHMARAVSRRLERRIKAASELTEINANVLLYANMLSNILFMHALISNKRLNIPEKIWSIHRV... 176
9 -90.4002g2d_A mol:protein length:193 ATP:cobalamin adenosyltransferase  ali model follow..  33  7RIYTRTGDDGTTGLSDMSRVAKTDARLVAYADCDEANAAIGAALALGHP-DTQITDVLRQIQNDLFDAGADLSTPIVENPKPPLRIAQSYIDRLEGWCDAYNAGLPALKSFVLPGGSPLSALLHVARTVVRRAERSAWAAVDAHPVSVLPAKYLNRLSDLLFILSRVANPDGDVLWRPGGDRTA... 192
10 -90.4001nog_A mol:protein length:177 conserved hypothetical protein TA0546  ali model follow..  31  1.MFTRRGDQGETDLANRARVGKDSPVVEVQGTIDELNSFIGYALVLSR--WDDIRNDLFRIQNDLFVLGEDVSTGGKGRT-----VTREMIDYLEARVKEMKAEIGKIELFVVPGGSVESASLHMARAVSRRLERRIVAASKLTEINKNVLIYANRLSSILFMHALISNKRLNIPEKIWSIHR.... 175
11 -90.2001rty_A mol:protein length:193 yvqk protein  ali model follow..  48  2KLYTKTGDKGQTGLVGG-RTDKDSLRVESYGTIDELNSFIGLALAELSGQPEDLTAELLTIQHELFDCGGDLAIVTERKDY---KLTEESVSFLETRIDAYTAEAPELKKFILPGGSKCASLLHIARTITRRAERRVVALMKSEEIHETVLRYLNRLSDYFFAGARVVNARSGIGDVEYERSAIVFR 186
12 -89.9002ah6_A mol:protein length:208 BH1595, unknown conserved protein  ali model follow..  47  8RLYTRTGDKGKTSVIGG-RLAKDDTRVVAYGTTDELNSFVGSAITQLDENTADIRGELFKIQHELFDCGGDLAMLKVKEDR-PYKAKQEIVDFLEQRIDAYIKEAPELERFILPGGSEAAASLHVCRTIARRAERYVVRLQQEGEINPIVLKYLNRLSDYFFAVARVVNSRLQVPDVEYERSAIVFR 193
13 -89.0003ke4_A mol:protein length:213 Hypothetical Cytosolic Protein  ali model follow..  47  16KLYTKTGDKGTTSVIGG-RVDKDDIRVEAYGTIDEANSHIGYAMTKLQGGAIDIYNELENIQHELFDCGGDLAIVEQKIPY---KVTIVMVESLERKIDLYIEEAPPLERFILPGGSEAAATIHIARTVVRRAERSIVSLQKEVKINEVVLKYVNRLSDYLFAIARVINARLQVKDVEYNRSAVVFR 199
14 -88.0005cy5_A mol:protein length:172 T33-51H-A  ali model follow..  33  2RITTKVGDKGSTRLFGGEEVWKDDPIIEANGTLDELTSFIGEAKHYVD---EEMKGILEEIQNDIYKIMGEIGSKGKIEG-----ISEERIKWLAGLIERYSEMVNK-LSFVLPGGTLESAKLDVCRTIARRAERKVATVLREFGIGTLAAIYLALLSRLLFLLARVIEIEKNKLKEVRS....... 172
15 -87.0001wvt_A mol:protein length:172 hypothetical protein ST2180  ali model follow..  32  2.WYTGTGDKGKTKVPSVGEVWKDSEIVKALGDLDELNSVLGVVSSLY----PELSEVIQKLQNDIFSISSEIAGFDMN-------FSDEKVKGIEELITNYSKELEPLRNFVLPGGHIASSFLHLARAVCRRAERSVVTLLKESKAKEVHAKYLNRLSSLLFVLALVVNKRTNNPNVIWRGKD.... 172
16 -86.5001wy1_A mol:protein length:172 hypothetical protein PH0671  ali model follow..  32  2RITTKVGDKGSTRLFGGEEVWKDSPIIEANGTLDELTSFIGEAKHYVD---EEMKGILEEIQNDIYKIMGEIGSKGKIEG------ISEERIKWLEGLISRYEEMVNLKSFVLPGGTLESAKLDVCRTIARRAERKVATVLREFGIGKEALVYLNRLSDLLFLLARVIEIEKNKLKEVRS....... 172
17 -86.2004nwp_A mol:protein length:172 Putative uncharacterized protein  ali model follow..  30  2RITTKVGDKGSTRLFGGEEVWKDSPIIEANGTLDELTSFIGEAKHYVD---EEMKGILEEIQNDIYKIMGEIGSKGKIEG------ISEERIAWLLKLILRYMEMVNLKSFVLPGGTLESAKLDVCRTIARRALRKVLTVTREFGIGAEAAAYLLALSDLLFLLARVIEIEKNKLKEVRS....... 172
18 -83.5001woz_A mol:protein length:177 177aa long conserved hypothetical protein (ST1454)  ali model follow..  36  1.MFTKSGDDGNTNVI-NKRVGKDSPLVNFLGDLDELNSFIGFAISKIP--WEDMKKDLERVQVELFEIGEDLSTQSSKKK-----IDEKYVKWLEERTVEYRKESGPVKLFVIPGGSEEASVLHVTRSVARRVERNAVKYTKEPEINRMIIVYLNRLSSLLFAMALVANKRRNVSEKIYDIGKF... 176
19 -78.5005im6_A mol:protein length:157 Designed self-assembling icosahedral cage I32-28 trimeric subunit  ali model follow..  35  2.....................GDDARIAAIGDVDELNSQIGVLLAEPL--PDDVRAALSAIQHDLFDLGGELCIPGHA------AITEDHLLRLALWLVHYNGQLPPLEEFILPGGARGAALAHVCRTVCRRAERSIKALGASEPLNIAPAAYVNLLSDLLFVLARVLNRAAGGADVLWDRTRA... 156
20 -11.8006c9k_A mol:protein length:319 DARP14 - Subunit A with DARPin  ali model follow..  33  2RITTKVGDKGSTRLFGGEEVWKDSPIIEANGTLDELTSFIGEAKHYVDEEMKGI---LEEIQNDIYKIMGEIGS-----KGKIEGISEERIAWLLKLILRYMEMVN-LKSFVLPGGTLESAKLDVCRTIARRALRKVLTVTREFGIGAEAAAYLLALSDLLFLLARVIEIELGKK............ 167

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.