current user: public

If you have questions about the server, please let us know.

Query: d3hp0a_ c.14.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}, from SCOP207

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst TYQTIKVRFQASVCYITFHRPEANNTINDTLIEECLQVLNQCETSTVTVVVLEGLPEVFCFGADFQEIYQEMKRGRKQASSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYPACVLPFLIRRIGRQKAHYMTLMTKPISVQEASEWGLIDAFDAESDVLLRKHLLRLRRLNKKGIAHYKQFMSSLDHQVSRAKATALTANQDMFSDPQNQMGIIRYVETGQFLast
1 -96.3003hp0_A mol:protein length:267 Putative polyketide biosynthesis enoyl-CoA hydratase homolog pksH  ali model follow..  100  5TYQTIKVRFQASVCYITFHRPEANNTINDTLIEECLQVLNQCETSTVTVVVLEGLPEVFCFGADFQEIYQEMKRGRKQASSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYPACVLPFLIRRIGRQKAHYMTLMTKPISVQEASEWGLIDAFDAESDVLLRKHLLRLRRLNKKGIAHYKQFMSSLDHQVSRAKATALTANQDMFSDPQNQMGIIRYVETGQ. 253
2 -92.2004nnq_A mol:protein length:268 Putative enoyl-CoA hydratase  ali model follow..  28  10THRGVRLTAEPHVLRATLTSPDGLNSLSGAALDALGAALDRAEDPECRVLLLEGSGGTFCTGLDFEEAAGDPAGGSQAGRGGAEFLALMRRFGETPLAVVACVDGRAAGGGVGLAAAADLVIATERSEFSLPEALWGLVPCCVLPVLVRRTGFQPAYAMALSTQPVSARRAADFRLVDEVVPDPDAAVRRLLVRLTRLDPATIGELKQYFRAMWFTTEDTDAFALREFTRLIDSPVARRRITDYTTTRR. 260
3 -88.4003oc7_A mol:protein length:267 Enoyl-CoA hydratase  ali model follow..  22  9VDYAGPAATGGPVARLTLNSPHNRNALSTALVSQLHQGLRDASDPAVRVVVLAHTGGTFCAGADLSEAGSGGSPSDMAVERAREMAALMRAIVESRLPVIAAIDGHVRAGGFGLVGACDIAVAGPRSSFALTEARIGVAPAIISLTLLPKLSARAAARYYLTGEKFDARRAEEIGLITMAAEDLDAAIDQLVTDVGRGSPQGLAASKALTTAVLERFDRDAERLAEESARLFVSDEAREGMLAFLEKRS. 262
4 -88.2004zu2_A mol:protein length:272 Putative isohexenylglutaconyl-CoA hydratase  ali model follow..  25  5HCETLLLEPIEGVLRITLNRPQSRNAMSLAMVGELRAVLAAVRDRSVRALVLRGADGHFCAGGDIKDMAGARAAGAEARTLNRAFGSLLEEAQAAPQLLVALVEGAVLGGGFGLACVSDVAIAAADAQFGLPETSLGILPAQIAPFVVRRIGLTQARRLALTAARFDGREALRLGLVHFCEADADALLEETLEQLRRCAPNANAATKALLLAESGELGALLDDAARQFAEAVGGAEGSEGTLAFVQKRK. 259
5 -87.8001uiy_A mol:protein length:253 Enoyl-CoA Hydratase  ali model follow..  22  1....MVQVEKGHVAVVFLNDPERRNPLSPEMALSLLQALDDLEDPGVRAVVLTGRGKAFSAGADLAFLERVTELGEENYRHSLSLMRLFHRVYTYPKPTVAAVNGPAVAGGAGLALACDLVVMDEEARLGYTEVKIGFVAALVSVILVRAVGEKAAKDLLLTGRLVEAREAKALGLVNRIAPPGKALAKALAEEVAKNAPTSLRLTKELLLLPGMGLEDGFRLAALANAWVRETGDLAEGIRAFFEKRP. 250
6 -87.8003i47_A mol:protein length:268 Enoyl CoA hydratase/isomerase (Crotonase)  ali model follow..  21  2SLSDLLYEIQDKVGLLTMNRISKHNAFDNQLLTEMRIRLDSAIDTNVRVIVLKANGKHFSAGADLTWMQSMANFTEEENEDSLVLGNLMYSISQSPKPTIAMVQGAAFGGGAGLAAACDIAIASTSARFCFSEVKLGLIPAVISPYVVRAIGERAAKMLFMSAEVFDATRAYSLNLVQHCVPDDTLLTLKYASQISNNAPEAVKNSKQLAQYVANK-EELVRYTASLIAHKRVSDEGQEGLKAFLNKEI. 256
7 -87.5004knp_A mol:protein length:285 enoyl-CoA hydratase  ali model follow..  22  21VDYAGPAATGGPVARLTLNSPHNRNALSSALVSQLHQGLRDASDPAVRVVVLAHTGGTFCAGADLSEAGSGGSPSDMAVERAREMAALMRAIVESRLPVIAAIDGHVRAGGFGLVGACDIAVAGPRSSFALTEARIGVAPAIISLTLLPKLSARAAARYYLTGEKFDARRAEEIGLITMAAEDVDAAVDQLVADVGRGSPQGLAASKALTTAVLERFDRDAERLAEESARLFVSDEAREGMLAFLEKRS. 274
8 -85.8004kpk_A mol:protein length:314 Enoyl-CoA hydratase/isomerase  ali model follow..  24  31QLHYLSCTLNGGVAQMVLDRSDKHNAFDEVMISEMIQVLEHFKNEQCQILLLKANGKNFSAGADLNWMRKQAKMDEQNLADANELARLMSMLDKFPKPTITLVQGAAFGGALGLICCSDIAIANERASFCLSEVKLGLIPAVISPYVTRAMGQRAARRYMLTAERFDAQKALELQIIHDINDDLDAAAQPFIDALLSNSPQGMAWVKCLLSSLEDG-QNTLDHTSERIARIRVSEEGQEGLNAFFEKRS. 283
9 -85.7003fdu_A mol:protein length:266 Putative enoyl-CoA hydratase/isomerase  ali model follow..  19  3LHPHLNANLEGGVLTLAINRPEAKNALYGELYLWIAKALDEADNKDVRVVVLRGAEHDFTAGNDMKDFMGFVQNPNAGPAGQVPPFVLLKSAARLSKPLIIAVKGVAIGIGVTILLQADLVFADNTALFQIPFVSLGLSPGGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEIVEDAYATAQATAQHLTALPLASLKQTKALMKHDLDQIIECIDHEAEIFMQRVQSPEMLEAVQAFMQKRQ. 253
10 -85.5004k3w_A mol:protein length:296 Enoyl-CoA hydratase/isomerase  ali model follow..  22  22QCETLILEKQGPTLVITINRPDVRNAMSLQMVAELSTIFSEIEDISIRAAVLRGAGGHFCAGGDIKDMAGARSQKAGEGKLNRAFGQMIQQVNESSKVVIAITEGAVMGGGFGLACVSDLAIAGPTAKFGMPETTLGVIPAQIAPFVVERIGLTQARRLALLGLRIDATEACKLGIVHQVAESEEQLLNQALERVRLCAPDATAETKALLHRVHEAMAGLLDDAAEKFAAAIRGPEGAEGTMAFMQKRE. 281
11 -85.2005dtp_A mol:protein length:263 Probable enoyl-CoA hydratase echA6  ali model follow..  20  12GSAMIGITQAEAVLTIELQRPERRNALNSQLVEELTQAIRKAGDGSARAIVLTGQGTAFCAGADLSGDAFA-------ADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGLALDWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIGTLADAQ--AWAAEIARLAPLAIQHAKRVLND-DGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRP. 251
12 -85.0003he2_A mol:protein length:264 enoyl-CoA hydratase echA6  ali model follow..  20  13PGSMIGITQAEAVLTIELQRPERRNALNSQLVEELTQAIRKAGDGSARAIVLTGQGTAFCAGADLSGDAFA-------ADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGLALDWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIGTLADAQ--AWAAEIARLAPLAIQHAKRVLND-DGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRP. 252
13 -84.3002iex_A mol:protein length:272 Dihydroxynapthoic acid synthetase  ali model follow..  20  10DYEDIIYETYNGIAKITINRPEVHNAFRPKTVNEMIDAFTKARDSNIGVIILTGAGKAFCSGGDQKVRGHGGYVGEDEIP-RLNVLDLQRLIRVIPKPVIAMVAGYAIGGGHVLHVVCDLTIAADNAIFGQTGPKVGSFDGYGAGYLARIVGHKKAREIWYLCRQYTAQEALEMGLVNKVVPLEQLETVKWAQEILEKSPTAIRFLKAAFNADSDGLAGIQQLAGDATLLFYTTEEAKEGMRAFKEKRK. 262
14 -84.2005zai_A mol:protein length:259 3-hydroxypropionyl-coenzyme A dehydratase  ali model follow..  24  2EFETIETKKEGNLFWITLNRPDKLNALNAKLLEELDRAVSQAEDPEIRVIIITGKGKAFCAGADITQFNQLTPA--EAWKFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALACDIRIAAEEAQLGLPEINLGIYPGGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNRVVPLANLETRKLAEKIAKKSPISLALIKEVVNGLDSPLLSGLALESVGWGVVFSTEDKKEGVSAFLEKRE. 253
15 -84.0002uzf_A mol:protein length:273 NAPHTHOATE SYNTHASE  ali model follow..  21  11EYDEIKYEFYEGIAKVTINRPEVRNAFTPKTVAEMIDAFSRARDQNVSVIVLTGEGLAFCSGGDQKKRGHGGYVGEDQIP-RLNVLDLQRLIRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDAYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVETVQWCKEIMKHSPTALRFLKAAMNADTDGLAGLQQMAGDATLLYYTTDEAKEGRDAFKEKRD. 263
16 -83.9003rrv_A mol:protein length:276 enoyl-CoA hydratase/isomerase  ali model follow..  18  20MPTEIDVRADGALRIITLNRPDSLNSVNDDLHVGLARLWQRLTDPTARAAVITGAGRAFSAGGDFGYLKELSADADLRAKTIRDGREIVLGMARCRIPVVAAVNGPAVGLGCSLVALSDIVYIAENAYLADPHVQVGLVAAGGPLTWPLHISLLLAKEYALTGTRISAQRAVELGLANHVADDPVAEAIACAKKILELPQQAVESTKRVLNHLERAVLASLDYALSAESQSFVTEDFRSIVTKLADKN.. 270
17 -83.8002vx2_A mol:protein length:287 ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3  ali model follow..  21  25EPRPTSARQLDGIRNIVLSNPKKRNTLSLAMLKSLQSDILHDDSNDLKVIIISAEGPVFSSGHDLKELTEEQGRD-YHAEVFQTCSKVMMHIRNHPVPVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQTMRIARKIASLSRPVVSLGKATFKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRK. 276
18 -83.6004izb_A mol:protein length:275 Enoyl-CoA hydratase/isomerase family protein  ali model follow..  20  8GYSNLDLDLDNGVCVVTLNRPDKRNALDVATIEELVTFFSTAHRKGVRAVVLTGAGDHFCAGLDLVEHWKADRSADDFMHVCLRWHEAFNKMEYGGVPIIAALRGAVVGGGLELASAAHLRVMDQSTYFALPEGQRGIFTGGATIRVSDMIGKYRMIDMILTGRVYQGQEAADLGLAQYITEGSSFKAMELADKIASNLPLTNFAICSAISMQNMSGLDAAYAEAFVGGIVNTQPAARERLEAFANKTA. 260
19 -83.6003qmj_A mol:protein length:256 Enoyl-CoA hydratase, EchA8_6  ali model follow..  21  4SMVTLQIDDDNRVRTLTLNRPEALNAFNEALYDATAQALLDAADPQVAVVLLTGSGRGFSAGTDLAEMQARITDP-NFSEGKFGFRGLIKALAGFPKPLICAVNGLGVGIGATILGYADLAFMSSTARLKCPFTSLGVAPEASSYLLPQLVGRQNAAWLLMSSEWIDAEEALRMGLVWRICSPEELLARRHAEILAAKPISSLMAVKHTMVPNRAQIAAASARENAHFAELMGAQANAAALADFTDRRR. 256
20 -83.6002ej5_A mol:protein length:257 Enoyl-CoA hydratase subunit II  ali model follow..  22  2.YETIRYEVKGQVAWLTLNRPDQLNAFTEQMNAEVTKALKQAGDPNVRCVVITGAGRAFCAGEDLSGVTEEMDHGDV---LRSRYAPMMKALHHLEKPVVAAVNGAAAGAGMSLALACDFRLLSEKASFAPAFIHVGLVPDGHLYYLPRLVGRAKALELAVLGEKVTAEEAAALGLATKVIPLSDWEVKQFAERLSAMPTKAIGLIKRLLRSEETTFDRYLEREAECQRIAGLTSDHREGVKAFFEKRK. 251
21 -83.6003rsi_A mol:protein length:265 Putative enoyl-CoA hydratase/isomerase  ali model follow..  20  7AARELLVERDGPVVILTMNRPHRRNALSTNMVSQFAAAWDEIDDDGIRAAILTGAGSAYCVGGDLSDGWMVRDGSAPP-LDPATIGKGLLLSHTLTKPLIAAVNGACLGGGCEMLQQTDIRVSDEHATFGLPEVQRGLVPGGSMVRLKRQIPYTKAMEMILTGEPLTAFEAYHFGLVGHVVPAGTALARSLADRIVRNGPLAVRNAKEAIVSGWLAEEDARAIEARLTRPVITSADAREGLAAFKEKRE. 259
22 -83.5002pbp_A mol:protein length:258 Enoyl-CoA hydratase subunit I  ali model follow..  19  3EFVSIAARQEGAVGIIELARPDVLNALSRQMVAEIVAAVEAFDNEKVRVIVLTGRGRAFAAGADIQEMAKDDPIR----LEWLNQFADWDRLSIVKTPMIAAVNGLALGGGFELALSCDLIVASSAAEFGFPEVNLGVMPGGGTQRLTKLIGPKRALEWLWTGARMSAKEAEQLGIVNRVVSPELLMTMRLAGRLAEQPPLALRLIKEAVQAVDYPLYEGMQFERKNFYLLFASEDQKEGMAAFLEKRK. 252
23 -83.5004fzw_A mol:protein length:258 2,3-dehydroadipyl-CoA hydratase  ali model follow..  22  3SMSELIVSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAADTSISVCVITGNARFFAAGADLNEMAEKDLAA----TLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAGENARFGLPEITLGIMPGGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPSDLTLALQLASKMARHSPLALQAAKQALRSQEVALQAGLAQERQLFTLLAATEDRHEGISAFLQKRT. 252
24 -83.5004lk5_A mol:protein length:292 enoyl-CoA hydratase  ali model follow..  19  27PVAGLDVTLSDGVFSVTINRPDSLNSLTVPVITGIADAMEYAADPEVKVVRIGGAGRGFSSGAGISADDVSDGGGVPPDEIILEINRLVRAIAALPHPVVAVVQGPAAGVGVSIALACDVVLASENAFFMLAFTKIGLMPDGASALVAAAVGRIRAMQMALLPERLPAAEALAWGLVTAVYPADEFEVDKVIARLLSGPAVAFAKTKLAINATLTELDPALQREFDGQSVLLKSPDFVEGATAFQQRRT. 280
25 -83.4003myb_A mol:protein length:286 Enoyl-CoA hydratase  ali model follow..  22  20..LLLQDRDERGVVTLTLNRPQAFNALSEAMLAALGEAFGTLADESVRAVVLAASGKAFCAGHDLKEMRAEPSREYYE-KLFARCTDVMLAIQRLPAPVIARVHGIATAAGCQLVAMCDLAVATRDARFAVSGINVGLFCSTPGVALSRNVGRKAAFEMLVTGEFVSADDAKGLGLVNRVVAPKALEIEAMVSKIVAKPRAAVAMGKALFYQIETDIESAYADAGTTMACNMMDPSALEGVSAFLEKRR. 269
26 -83.3003tlf_A mol:protein length:274 enoyl-CoA hydratase/isomerase  ali model follow..  24  9SFDTIKYEVDGHTATITLNRPDALNALSPHMITELRAAYHEAEDDRVWLLVVTGTGRAFCSGADVKEIPEDGKVIYERYDQWEAPQEGTPPFRTMAKPVLTAVNGICCGAGMDWVTTTDIVIASEQATFFDPHVSIGLVAGRELVRVSRVLPRSIALRMALMGERMSAQRAYELGLISEIVEHDRLLAHEIADIVNSNAPLAVRGTRLAIKGLNVPLHEAEILAETFRERVLRTEDAAEGPRAFVEKRQ. 268
27 -83.3002j5i_A mol:protein length:276 P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE  ali model follow..  22  7RWKTVKVEIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETLEDPAAGVLVLTGAGEAWTAGMDLKEYFREVDAGPEEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGLVSKAMADTVGHRQSLMYIMTGKTFGGQKAAEMGLVNESVPLAQLRTIELARNLLEKNPVVLRAAKHGFKCRELTWEQNEDYLYAQSRLLDTEGGREQGMKQFLDDKS. 266
28 -83.2005xzd_A mol:protein length:258 Enoyl-CoA hydratase  ali model follow..  20  2AYETIIVEVEDHVALITLNRPDALNALNDQLLSELVKALEDAQNDKVRCIVITGSEKAFAAGADIKMMSEKSFVDVFAGD---LFGPEAEGIMRIRKPIIAAVSGYALGGGCELAMMCDFIICSDTAKFGQPEINLGVIAGGGSQRLTRFIGKSKSMDMNLTGRFMDAEEAERSGLVSRVVPAKKLMTMTAAQKIAEKSMIAVMAVKEAVNSYEVPLREGLLFERRVFQSLFATEDQKEGMSAFAEKRE. 252
29 -83.2002vsu_E mol:protein length:276 P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE  ali model follow..  22  7RWKTVKVEIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETLEDPAAGVLVLTGAGEAWTAGMDLKEYFREVDAGPEEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINYGIPPGLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLRTIELARNLLEKNPVVLRAAKHGFKCRELTWEQNEDYLYAQSRLLDTEGGREQGMKQFLDDKS. 266
30 -83.1004jfc_A mol:protein length:281 Enoyl-CoA hydratase  ali model follow..  21  18.AGAIKSTSEGQTLILTLSNPEFRNALGPEIYAAGIEALNAAENPEIRSVVITGEGAVFCAGGNLQRLQANRREAPEVAQSIEGLHNWIDSIRTYPKPVIAAVEGAAAGAGFSLALACDFVVAASNAVFVMSYSTVGLSPDGGSWSLARSLPRALASELLMGGERISAQRLHDLGLVNKVASAGDALALRMAGQLNARAPNALASIKELINASSNTLSQQLACERDHFVRNLHHSNGGEGIAAFLGKRT. 271
31 -83.1003h81_A mol:protein length:278 enoyl-CoA hydratase echA8  ali model follow..  22  17TYETILVERDQRVGIITLNRPQALNALNSQVMNEVTSAATELDDPDIGAIIITGSAKAFAAGADIKEMADLTFAD----AFTADFFATWGKLAAVRTPTIAAVAGYALGGGCELAMMCDVLIAADTAKFGQPEIKLGVLPGGGSQRLTRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVVPADDLLARATATTISQMSASAARMAKEAVNAFESSLSEGLLYERRLFHSAFATEDQSEGMAAFIEKRA. 266
32 -83.1004nek_A mol:protein length:252 Enoyl-CoA hydratase/carnithine racemase  ali model follow..  13  2.SELVLSHVEGGVQVVRMNRPDKKNALIGEMYAALAEAFAKGEDDDVNVFLILGSQTDFSAGNDLPDFLTWEALS------GSVADRFIRAVAGARKPVVAAVRGAAIGIGSTLLPHCDLVYAAPGTRFHMPFINLGIVPEGSSQTMPALAGHRRAAEMLMLGEPFGVDTAEAVGLINGVVPGEDLEAMAAARKLAAKPRSILVQIKALMKTPAEPIMDRLTREAAVFDTCLKGEALNEAVSAFKEKRA. 247
33 -83.1004f47_A mol:protein length:278 Enoyl-CoA hydratase EchA19  ali model follow..  18  18SGPDALVEQRGHTLIVTMNRPSRRNALSGEMMQIMVEAWDRVDDPDIRCCILTGAGGYFCAGMDLKAATKKPPGDSKDGSYDPSRIDALLKGRRLKKPLIAAVEGPAIAGGTEILQGTDIRVAAESAKFGISEAKWSLYPMGSAVRLVRQIPYTVACDLLLTGRHITAAEAKEMGLVGHVVPDGQALALEIAEIIAANGPLAVQAILRTIRTEGMHENEAFKIDTRIGIEVFLSDDAKEGPQAFAQKRK. 272
34 -82.9005ylo_A mol:protein length:271 Probable enoyl-CoA hydratase/isomerase  ali model follow..  20  3DLSPLQTRVEAGIAWLVLNRPQQRNALDIPTLEALHVRLDACEDPAVRAVVLGGSGRSFCAGADLAEWAAAEARGEESYGWTEAAHALMGRLHALDKPTVAAVNGSAVGAGMDLALCCDFRIAAASARFKAGYTGMAYCPDGASWHLPRLLGSEAAKRLLFLDEAWSAERALGAGLVGEVVADEHLVVGAFAARLASGPTFAFAQTKRLLRGAGRSLAEQLRAEQAAGLLCGRSEDAAEALRAVAEKRS. 257
35 -82.9004eml_A mol:protein length:275 Naphthoate synthase  ali model follow..  18  8HYDDILYYKAGGIAKIVINRPHKRNAFRPQTVFELYDAFCNARDNRIGVVLLTGAGYAFCSGGDQSVRGEGGYIDDQGTP-RLNVLDLQRLIRSMPKVVIALVAGYAIGGGHVLHLVCDLTIAADNAIFGQTGPKVGSFDGFGSSYLARIVGQKKAREIWYLCRQYSAQEAERMGMVNTVVPVDRLEGIQWAKEILSKSPLAIRCLKAAFNADCDGQAGLQELAGNATLLYYMTEEGSEGKQAFLEKRP. 265
36 -82.9004olq_A mol:protein length:282 Enoyl-CoA hydratase/isomerase family protein  ali model follow..  16  18.TLPIRLDIAAPLAEIVLNKPERRNALSVDMWAAIPGLVAEANNPDVKLILIHGGDGAFAAGADISEFETIYATEDAAKASGQRIAQALDAIENSEKPVIAAIEGACVGGGVSLAMAADLRVAGEGAKFGVTPGKLGLVYPGDTRRLLAAVGPGATKDILFTGRIFTAGEAKSLGLIDRLVEKGTALARVWAGEIAAISQWSVRATKRMIRGLQTGWTDETPEAQSLFLNGFANEDFKEGYRAFLDKRP. 270
37 -82.8003isa_A mol:protein length:254 Putative enoyl-CoA hydratase/isomerase  ali model follow..  16  5ASLPLAIERRPAAWTFTLSRPEKRNALSAELVEALIDGVDAAHREQVPLLVFAGAGRNFSAGFDFTDYETQSEG--DLLLRMVRIEMLLQRVAGSPSLTLALAHGRNFGAGVDLFAACKWRYCTPEAGFRMPGLKFGLVLG--TRRFRDIVGADQALSILGSARAFDADEARRIGFVRDCAAQAQWLIDAAAEAATALDPATRATLHRVLR------DDHDDADLAALARSAAQPGFKARIRDYLAQPA. 245
38 -82.7001jxz_A mol:protein length:269 4-chlorobenzoyl Coenzyme A dehalogenase  ali model follow..  19  2.YEAIGHRVEDGVAEITIKLPRHRNALSVKAMQEVTDALNRAEDDSVGAVMITGAEDAFCAGFYLREIPLDKGVADHFRIAALWWQQMIHKIIRVKRPVLAAINGVAAGGGLGISLASDMAICADSAKFVCAWHTIGIGNDATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFRAWKVARELAAAPTHLQVMAKERFHGWMQPVEECTEFEIQNVIASVTHPHFMPCLTRFLDGHR. 257
39 -82.7003swx_A mol:protein length:265 Probable enoyl-CoA hydratase/isomerase  ali model follow..  20  7DYETLRIRRDGYVLVIGLNRPAKRNAFDKTMLEELALALGEYEDTDLRAAVLYGEGPLFTAGLDLASVAAEIQGGASLTP-EGGINPWQVDGRQLSKPLLVAVHGKVLTLGIELALAADIVIADETATFAQLEVNRGIYPFGATIRFPRTAGWGNAMRWMLTADTFDAVEAHRIGIVQEIVPVGEHVAIAIAQTIARQAPLGVQATLRNARAVREGDAAAEEQLVPTVRELFTSEDATLGVQAFLSRTT. 259
40 -82.7003p5m_A mol:protein length:255 Enoyl-CoA hydratase/isomerase  ali model follow..  20  4SMNGISVEHDGAVLRIRLDRPEKLNAVDTPMLEELSVHIRDAEDESVRAVLLTGAGRAFCSGGDLTGGDTA--------GAADAANRVVRAITSLPKPVIAGVHGAAVGFGCSLALACDLVVAAPASYFQLAFTRVGLMPDGASALLPLLIGRARTSRMAMTAEKISAATAFEWGMISHITSADEYELTDVLRSVSGGPTLAFGWTKRALAATLAELEPVQAIEAEGQLALVETADFREGARAFRERRT. 249
41 -82.7003h02_A mol:protein length:288 Naphthoate synthase  ali model follow..  18  24GYTDIRYEKTDGIAKITINRPQVRNAFRPLTVKEMIQALADARDDNVGVIILTGEGKAFCAGGDQKVRGDYGGYQDDSGVHHLNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAAENAIFGQTGPKVGSFDGWGASYMARIVGQKKAREIWFLCRQYDAQQALDMGLVNTVVPLADLETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNQKRQ. 278
42 -82.7004jcs_A mol:protein length:286 Enoyl-CoA hydratase/isomerase  ali model follow..  20  16SMDTLDFEVVNNVGWIRMNRAAKHNPFDAELRADLMTVLERVRDADIRVLVLTSHPGSFCAGGNLHVLRDNLDSGPAYQQRIKTGLRFIHDMLNLGRPVIAAVDGPAFGAGFALSLTADIVLASPRARFSMAYLRLGLVPDGALYLLPRAVGLQRAKELMFSTRELDAEEAHRLGLVMEVHESEALEAREIAESLVQAAPTALALTKAALNSLDSDEQTMFSLEAASQAAAFSTKEPRAAIEALLSKQP. 270
43 -82.7003t88_A mol:protein length:289 1,4-Dihydroxy-2-naphthoyl-CoA synthase  ali model follow..  17  25GFEDIRYEKTDGIAKITINRPQVRNAFRPLTVKEMIQALADARDDNIGVIILTGAGKAFCSGGDQKVRGDYGGYKDDSGVHHLNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAADNAIFGQTGPKVGSFDGWGASYMARIVGQKKAREIWFLCRQYDAKQALDMGLVNTVVPLADLETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNQKRQ. 279
44 -82.6004fzw_C mol:protein length:274 1,2-epoxyphenylacetyl-CoA isomerase  ali model follow..  21  7MMEFILSHVEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVEDDTIRCLLLTGAGRGFCAGQDLNDRNVDPTGPAPDMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALGGDIVIAARSAKFVMAFSKLGLIPDGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWGMIWQVVDDETLAAQQLARHLATQPTFGLGLIKQAINAETNTLDTQLDLERDYQRLAGRSADYREGVSAFLAKRS. 262
45 -82.5005kjp_A mol:protein length:265 Enoyl-CoA hydratase  ali model follow..  19  13TEPEVLVEQRDRILIITINRPKAKNAVNAAVSRGLADAMDQLDDAGLSVAILTGGGGSFCAGMDLKAFARGENVVVEG-------RGLGFTERPPTKPLIAAVEGYALAGGTELALAADLIVAARDSAFGIPEVKRGLVAGGGLLRLPERIPYAIAMELALTGDNLPAERAHELGLVNVLAEPGTALAIALAEKITANGPLAVVATKRIITSRGWSPDTMFAEQMKILVPVFTSNDAKEGAIAFAERRR. 259
46 -82.5004mou_A mol:protein length:294 Enoyl-CoA hydratase/isomerase family protein  ali model follow..  20  27RTGRISVAIADGVASVEISNLAQRNALTKDMCLEIQELMPQLDDPDVAVVVLRGAGDTFCAGASISELASVLLDPQPDGSTADHLSRADSAIAALSKPAVALVDGACMGGGWQIASACDFIIANERAVIGLTPAKIGIIYPPGLERLVRLVGHANAKYILLTGQTFSAPEARALGLVADVVPSESFECAALVRSLRSRSRFSMHSMKRLVDTDSVPAAGIDQEWAAAWSAMPDSPDMGIGISAFLNREQ. 280
47 -82.4003qxi_A mol:protein length:265 Enoyl-CoA hydratase EchA1  ali model follow..  19  13TEPEVLVEQRDRILIITINRPKAKNSVNAAVSRALADAMDRLDDAGLSVGILTGAGGSFCAGMDLKAFARGENVVVEG-------RGLGFTERPPAKPLIAAVEGYALAGGTELALATDLIVAARDSAFGIPEVKRGLVAGGGLLRLPERIPYAIAMELALTGDNLSAERAHALGMVNVLAEPGAALAIALAEKITANGPLAVAATKRIITSRGWSLDTRFAQQMKILFPIFTSNDAKEGAIAFAEKRP. 259
48 -82.4003hrx_A mol:protein length:254 Probable enoyl-CoA hydratase  ali model follow..  19  2....VLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEDREVRALLLTGAGRAFSAGQDLTEFGDRKP---DYEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASFTTAFVRIGLVPDGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMALSLAKELAQGPTRAYALTKKLLLTYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFREKRP. 248
49 -82.3003g64_A mol:protein length:279 Putative enoyl-CoA hydratase  ali model follow..  18  15EWRHLRVEITDGVATVTLARPDKLNALTFEAYADLRDLLAELSRRAVRALVLAGEGRGFCSGGDVDEIIGATLSMDTARDFNRMTGQVVRAVRECPFPVIAALHGVAAGAGAVLALAADFRVADPSTRFAFLFTRVGLSGGGAAYLLPRVVGLGHATRLLMLGDTVRAPEAERIGLISELTEEGRADARTLARRLADGPALAHAQTKALLTELDMPLAAAVELDASTQALLMTGEDYAEFHAAFTEKRP. 271
50 -82.1002a7k_A mol:protein length:250 CarB  ali model follow..  17  2....VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANDDSVRAVVVYGGARSFSAGGDFNEVKQL-SRSEDIEEWIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAAILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLAITQAHVMASYPASAFINTKRAVNPFIHLLEQTRDASKAVHKAAFQARDAQGHFKNVLGKK.. 249
51 -82.0003trr_A mol:protein length:256 Probable enoyl-CoA hydratase/isomerase  ali model follow..  20  6.ADEVLIEQRDRVLLITINRPDARNAVNRAVSQGLAAAADQLDSADLSVAIITGAGGNFCAGMDLKAFVSGEAVLSER--------GLGFTNVPPRKPIIAAVEGFALAGGTELVLSCDLVVAGRSAKFGIPEVKRGLVAGGGLLRLPNRIPYQVAMELALTGESFTAEDAAKYGFINRLVDDGQALALELAAKITANGPLAVAATKRIIISASWAPEEAFAKQGEILMPIFVSEDAKEGAKAFAEKRA. 250
52 -81.9003hin_A mol:protein length:275 Putative 3-hydroxybutyryl-CoA dehydratase  ali model follow..  18  14DPSTLVVDTVGPVLTIGLNRPKKRNALNDGLMAALKDCLTDI-PDQIRAVVIHGIGDHFSAGLDLSELRERDAT--EGLVHSQTWHRVFDKIQYCRVPVIAALKGAVIGGGLELACAAHIRVAEASAYYALPEGSRGIFVGGGSVRLPRLIGVARMADMMLTGRVYSAAEGVVHGFSQYLIENGSAYALELGNRVAQNAPLTNFAVLQALPIAEANPQTGLLMESLMATVAQSDQEAKTRIRAFLDHKT. 263
53 -81.7004og1_A mol:protein length:290 Enoyl-CoA hydratase/isomerase  ali model follow..  16  22FHDRVSVTIEDHVAHVLLDRADKMNALDDAMFEGIVAAGHHLHVKGVRCVVLSGAGRSFCAGLDLSSMGRTDRWSGNSHGNANRAQQAAMVWRKLPMPVIAAVHGVCFGGGLQVASGADIRFITPDARLAVMEVKWGLVPDAGYALWRGNVRDDVLRELTYTHREFSGEEAVRFGFATHVADDPLAGAMELARVVAEKSPNAVRGAKTLSNAPDLTVDDVLMAESIAQHELMYSRNQMEAVKAGMEKRA. 278
54 -81.5003pea_A mol:protein length:261 Enoyl-CoA hydratase/isomerase family protein  ali model follow..  20  4MLKFLSVRVEDHIAVATLNHAPA-NAMSSQVMHDVTELIDQVEDDNIRVVVIHGEGRFFSAGADIKEFTSVTEAK-QATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMRFATESAKLGLPELTLGLIPGAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGVFAEETFLTLKVAKQIAGKSPATARAVLELLQTKSSHYYEGVQREAQIFGEVFTSEDGREGVAAFLEKRK. 255
55 -81.4003moy_A mol:protein length:263 Probable enoyl-CoA hydratase  ali model follow..  24  7TYTTIATSRVAGVGLIRLDRPDALNALNQTLEAEVLDAARDFDDLEIGAIVVTGSERAFAAGADIAEMVTLTPHQ----ARERNLLSGWDSLTQVRKPIVAAVAGYALGGGCELAMLCDLVIAADTARFGQPEITLGILPGGGTQRLTRAVGKAKAMDLCLTGRSLTAEEAERVGLVSRIVPAADLLALAVAQRIARMSRPAGRAVKDAINAFERPLSAGMRYERDAFYAMFDTHDQTEGMTAFLEKRT. 257
56 -81.4004wcz_A mol:protein length:272 Enoyl-CoA hydratase/isomerase  ali model follow..  18  16QSMSLRLERDGAVARLLIDRADRRNAFSLDMWQRLPELLAEASDDALRVLVVKSANGAFCAGADIAELLANKDDAAFHAANQQAINRAQYELARFRLPTVAMVEGDCIGGGCGIALACDMRIAAPAARFGITPAKLGLVYPHDVKLLVDLVGPGQARRLMFTGGLIDANEAHRIGLVELLGESEDA----LVGQLATVSSFSTQAIKSFVRRVLDGQVADDADSLRVFASAFEGADFREGTGAFLEKRP. 263
57 -81.3005ve2_A mol:protein length:275 Enoyl-CoA hydratase  ali model follow..  15  18.SKSLNVSLNNRVLSLTINRPELKNALNRELYAALADELERSNDDQIRAVLLTANGDTFTAGNDLDDFINPVEESGT-----PSVIRFLKAISECETPIVVAVNGPAIGVGLTMLLHCDMVYASKSARFRAPFTHVGLVPEASSLLLPLAVGQAWANDLMLAGRILDAREALSAGLVTRVFEDDVLVSLKIAEQVASLAPNSVKQSKRLIRVNKEEVQAQMKREGVIFAEQLASAEFKESVAAFFEKRA. 265
58 -81.2001dub_A mol:protein length:261 2-ENOYL-COA HYDRATASE  ali model follow..  23  3NFQYIITEKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQD----CYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVAIQCAEKIANNSKIIVAMAKESVNAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRK. 255
59 -81.1004jwv_A mol:protein length:278 Short chain enoyl-CoA hydratase  ali model follow..  20  16SMADIDFRIEGHVAHVRLNRPQGLNAITQEMDDLLLDAWTEVNNSDIWAVVLSAEGKAFCIGADVSGGAERKTRM----ALGGGLTGIGGPLVTCKKPMVAAVQGFCVGGGFELAMCADIIVAADTAQFGLPETKVGIIGEGVVHRAMRQLPYHIALQLILTGERIKADEARHYGLVNEVVPFAELEALRWASKLNAASPLAVQAAKAAALRLGHPLEVALMTRFEPIEEYAATEDKKEGERAAGERRK. 266
60 -81.0004di1_A mol:protein length:277 Enoyl-CoA hydratase EchA17  ali model follow..  18  17.NEFVSVVADQGLATLVVSRPP-TNAMTRQVYREIVAAADELGRDDIGAVVLFGGHEIFSAGDDMPELRTLNAP--EADTAARVRLEAIDAVAAIPKPTVAAVTGYALGAGLTLALAADWRVSGDNVKFGATEILAGLIPGGGMGRLTRVVGSSRAKELVFSGRFFDAEEALALGLIDDMVAPDDVYAVAWARRYLECPPRALAAAKAVINVFELEATERAAAERRRYVELFAAGQRGPDGRGPGGGNT. 266
61 -81.0001wz8_A mol:protein length:264 enoyl-CoA hydratase  ali model follow..  21  8RYPGLAFAWRPGVLEITF-RGEKLNAMPPALHRGLARVWRDLEVEGVRAVLLRGEGGVFSAGGSFGLIEEMRASHEALLRVFWEARDLVLGPLNFPRPVVAAVEKVAVGAGLALALAADIAVVGKGTRLLDGHLRLGVAAGHAVLLWPLLVGMAKAKYHLLLNEPLTGEEAERLGLVALAVEDEKVYALEVAERLAQGPKEALHHTKHALNHWYRSFLPHFELSLALEFLGFSGKELEEGLKALKEKRP. 260
62 -81.0003pe8_A mol:protein length:256 Enoyl-CoA hydratase  ali model follow..  22  7DSPVLLVDTTDRVRTLTLNRPQSRNALSAELRSTFFRALSDAQDDDVDVVIVTGADPVFCAGLDLKELGDTTELP-----------DISPKWPDMTKPVIGAINGAAVTGGLELALYCDILIASENAKFADTHARVGLMPTGLSVRLPQKVGVGLARRMSLTGDYLSAQDALRAGLVTEVVAHDDLLARRVAASIVGNNQKAVRALLDSYHIDALQTGGALWAEAEAWMRSTSGDDIAASRASVIERGR. 252
63 -81.0005jbx_A mol:protein length:261 3-hydroxybutyryl-CoA dehydratase  ali model follow..  19  3HMPEFKVDARGPIEIWTIDGESRRNAISRAMLKELGELVTRVSSRDVRAVVITGAGKAFCAGADLKERATMAED--EVRAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAAPAAELGLTEVKLGIIPGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLAPEGHLLAYGLAESVVENAPIAVATAKHAIDGTGLELDDALALELRKYEEILKTEDRLEGLRAFAEKRA. 255
64 -80.9002fw2_A mol:protein length:260 Testis-specific chromodomain protein Y 2  ali model follow..  18  2TYRDIVVKKEDGFTQIVLSRSTEKNALNTEVIKEMVNALNSAAADDSKLVLFSAAGSVFCCGLDFGYFVRHLRNDRNTLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTVMIQIKELASYNAIVLEECKALVRNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKI. 257
65 -80.9004mi2_A mol:protein length:267 Putative enoyl-CoA hydratase/isomerase  ali model follow..  21  5APAAVAYSVHAGVAAIVLDRPEASNALDRTMKTELLQALLAAGDPAVRAVVMSAAGKNFCVGQDLAEHVEALRDDPAHDTVREHYNPVLEALDAIKVPVVVAINGACVGAGLGLALGADIRIAGQRAKFGTAFTGIGLAADALSASLPRLIGASRATAMFLLGDTIDAPTAHTWGLVHEVVDEGSPAANSVAGRLAGGPTAAFSEVKELLRNAVAPLGDVLEREASAQQRLGASRDHSAAVEAFLAKDK. 261
66 -80.8005z7r_A mol:protein length:267 Short-chain-enoyl-CoA hydratase  ali model follow..  21  2ELNNVILEKEGKVAVVTINRPKALNALNSDTLKEMDYVIGEIEDSEVLAVILTGAGKSFVAGADISEMKEMNTI--EGRKFGILGNKVFRRLELLEKPVIAAVNGFALGGGCEIAMSCDIRIASSNARFGQPEVGLGITPGGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGLVNKVVEPSELMAKEIANKIVSNAPVAVKLSKQAINGMQCDIDTALAFESEAFGECFSTEDQKDAMTAFIEKRK. 254
67 -80.8003ome_A mol:protein length:282 Enoyl-CoA hydratase  ali model follow..  18  15SMVYIDYGVADSIATITLNRPEAANAQNPELLDELDAAWTRAADNEVKVIILRANGKHFSAGHDLRGGGEVPEKISLEQHEARRYLDYTLRWRNVPKPSIAAVQGRCISGGLLLCWPCDLILASDDALFSDPVALMGIGGVE-YHGHTWELGPRKAKEILFTGRALTAEEAERTGMVNRVVARDELDTRELAEQIATMPPFALRQAKRAVNQ--QGFYAAIQSVFDIHQTGHGNALSVSGVLVDIEEMK. 272
68 -80.6002gtr_A mol:protein length:261 Chromodomain Y-like protein  ali model follow..  19  3RYRDIVVRKQDGFTHILLSKSSENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRRLTDDRESTKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTVMVRIKELASCNPVVLEESKALVRNMKMELEQANERECEVLKKIWGSAQGMDSMLKYLQRKI. 258
69 -80.6004jyl_A mol:protein length:265 Enoyl-CoA hydratase  ali model follow..  20  15QSMLVEIERRGDASLIVLSRPEKLNAINLEMLADLADQFSKAEKEDTRVIVITGYGKNFSAGADINMLASFDPA--SAYSFRLKMNSIAQRIRKSDKPVIALLKGYSMGGGLELAESADIRIAMSDAVIGQPESSIGINAGGGNVILPKLVGRGSAAYLAMSGKKLNAQEAMALGLVDEVVDDEA-KAWKIIDDICKKPKKTLQFIKRAINSYDMGLESAMDQEALYFSLLFTDPEVLDALSKWRK.... 259
70 -80.5003q1t_A mol:protein length:278 Enoyl-CoA hydratase  ali model follow..  18  17DFPSLRCELDDGVLTVVLDSPG-LNSVGPQMHRDLADIWPVIDDPAVRAVLVRGEGKAFSSGGSFDLIDETIGDYQGRIRIMREARDLVHNMINCDTPVVSAIRGPAVGAGLVVALLADISVAGRTAKLIDGHTKLGVAAGHAAICWPLLVGMAKAKYYLLTCETLLGEEAERIGLVSLCVDDDDVLAAGIAGKLAQGAQHAIQWTKRSLNHWYRMMGPTFETSVGLEFLSFSGPDVQEGLAAHREKRA. 269
71 -80.4003lao_A mol:protein length:258 enoyl-CoA hydratase/isomerase  ali model follow..  15  10GPGRVTREQRGHLFLIGLDRAGKRNAFDSAMLADLALAMGEYESEESRCAVLFAHGEHFTAGLDLMELAPKLAASGFRYP-DGGVDPWGVVQPRRSKPLVVAVQGTCWTAGIELMLNADIAVAARGTRFAHLEVLRGIPPLGSTVRFPRAAGWTDAMRYILTGDEFDADEALRMRLLTEVVEPGEELALEYAERIARAAPLAVRAALQSAFGRDEGDDAALSRVNESLAALIGSEDVREGVLAMV..... 258
72 -80.4003qk8_A mol:protein length:272 Enoyl-CoA hydratase EchA15  ali model follow..  18  11DFPSLRFEPEHGVLNLVLDSPG-LNSVGPQMHRDLADVWPVIDDPDVRVVLVRGEGKAFSSGGSFELIDETIGDYEGRIRIMREARDLVLNLVNLDKPVVSAIRGPAVGAGLVVALLADISVASATAKIIDGHTKLGVAAGHAAICWPLLVGMAKAKYYLLTCETLSGEEAERIGLVSTCVDDDEVLATRLAENLAQGAQNAIRWTKRSLNHWYRMFGPTFETSLGLEFLGFTGPDVQEGLAAHRQKRP. 263
73 -80.3003t8a_A mol:protein length:334 1,4-Dihydroxy-2-naphthoyl-CoA synthase  ali model follow..  17  49TDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARSPDVGVVLLTGNGWAFCSGGDQRIRGRSGYQYASGRAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASEYARFKQTDADVGSFDGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELEGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRP. 318
74 -80.3003r9s_A mol:protein length:267 Carnitinyl-CoA dehydratase  ali model follow..  21  7DAPGALAERRGNVMVITINRPEARNAVNAAVSIGVGDALEEAQDPEVRAVVLTGAGKSFCAGADLKAIARRENLYHPDHP---EWGFAGYVRHFIDKPTIAAVNGTALGGGTELALASDLVVADERAQFGLPEVKRGLIAAGGVFRIAEQLPRKVAMRLLLTGEPLSAAAARDWGLINEVVEAGSVLALALASAITVNAPLSVQASKRIAYGVVVGDEPGWDRTMREMRALLKSEDAKEGPRAFAEKRE. 261
75 -80.1003t3w_A mol:protein length:279 Enoyl-CoA hydratase  ali model follow..  18  18TEMYIDYDVSDRIATITLNRPEAANAQNPELLDELDAAWTRAADNDVSVIVLRANGKHFSAGHDLRGGGPVPDKLTLEAHESRRYLEYSLRWRNVPKPSIAAVQGRCISGGLLLCWPCDLIIAAEDALFSDPVVLMDIGGVE-YHGHTWELGPRKAKEILFTGRAMTAEEVAQTGMVNRVVPRDRLDTRALAGEIAKMPPFALRQAKRAVNQ--QGFYAAIQSVFDIHQTGHGNAMSVSGWPVLVDIEE. 273

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.