current user: public

If you have questions about the server, please let us know.

Query: d3ldqb1 a.7.7.1 (B:151-260) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst NSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQLast
1 -45.0005aqf_B mol:protein length:118 BAG FAMILY MOLECULAR CHAPERONE REGULATOR 1  ali model follow..  100  7.SPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ 115
2 -44.6001i6z_A mol:protein length:135 BAG-FAMILY MOLECULAR CHAPERONE REGULATOR-1  ali model follow..  83  13.NPEEEVELKKLKDLEVSAEKIANHLQELNKELSGIQQGFLAKELQAEALCKLDRKVKATIEQFMKILEEIDTMVLPEQFKDSRLKRKNLVKKVQVFLAECDTVEQYICQ 121
3 -37.5001t7s_A mol:protein length:137 BAG-1 cochaperone  ali model follow..  21  11ALVDDAGFKMLMQYEKHNLSNLQKAYDLNLRDVADLERGFLEKPKQVEMGKKLEKKVKYFNEEAERHLETLDGMNIITEAKRNREKRKTLVNGIQTLLNQNDALLRRLQE 126
4 -29.1004hwd_D mol:protein length:90 BAG family molecular chaperone regulator 2  ali model follow..  17  4......SSSKAISDISFQVERLAGQLSAFDTV-------------IGKGGKVEEKNLENLMEMLMNQLVKLDAISGDG---DVKLKKKMQEERLHKYVEALDLLKIK... 88
5 -29.0001ugo_A mol:protein length:99 Bcl2-associated athanogene 5  ali model follow..  18  10.MGNQHPSISRLQEIQREVKAIEPQVVGFSG-------------------LSDDKNYKRLERILTKQLFEIDSVDTEGK-GDIQQARKRAAQETERLLKELEQNASG... 95
6 -28.9004hwc_A mol:protein length:89 BAG family molecular chaperone regulator 1  ali model follow..  18  4......SASKAISDISLEVDRLGGRVSAFEMV-------------TKKGGKIAEKDLVTVIELLMNELIKLDAIVAEG---DVKLQRKMQVKRVQNYVETLDALKVK... 88
7 -28.6001uk5_A mol:protein length:111 BAG-family molecular chaperone regulator-3  ali model follow..  19  22.TPPKHPGVLKVEAILEKVQGLEQAVDSFEG-------------------KKTDKKYLMIEEYLTKELLALDSVDPEGR-ADVRQARRDGVRKVQTILEKLEQKASG... 107
8 -28.5004hwf_A mol:protein length:88 BAG family molecular chaperone regulator 3  ali model follow..  20  1.....GSASKSISDISFEVDRLAGQVSAFETVINK-------------GGKVEEKSLVNLIEMLMNQLLRLDAIIADG---DVKLMRKMQVQRVQKYVEALDLLKVK... 86
9 -28.4004hwh_A mol:protein length:88 BAG family molecular chaperone regulator 4  ali model follow..  17  1.....ALAIAAVNAVTGEVDKLSDRVVALEVA-------------VNGGTQVAVREFDMAAELLMRQLLKLDGIEAEG---DAKVQRKAEVRRIQNLQEAVDKLKAR... 86
10 -28.3001m7k_A mol:protein length:99 Silencer of Death Domains  ali model follow..  25  15SDESTPPSIKKIIHVLEKVQYLEQEVEEFVG-------------------KKTDKAYWLLEEMLTKELLELDSVETGGQ-DSVRQARKEAVCKIQAILEKLEKK...... 98
11 -28.2001m62_A mol:protein length:87 BAG-family molecular chaperone regulator-4  ali model follow..  25  2SPEFTPPSIKKIIHVLEKVQYLEQEVEEF-------------------VGKKTDKAYWLLEEMLTKELLELDSVETGGQ-DSVRQARKEAVCKIQAILEKLEK....... 84
12 -26.1003a8y_C mol:protein length:142 BAG family molecular chaperone regulator 5  ali model follow..  15  26.ACEEHPSHKAVWNVLGNLSEIQGEVLSF-------------------DGNRTDKNYIRLEELLTKQLLALDAVDPQGE-EKCKAARKQAVRLAQNILSYLDLKSDEWEY 114
13 -23.1004hwi_B mol:protein length:178 BAG family molecular chaperone regulator 1  ali model follow..  25  123..................................................KIAEKDLVTVIELLMNELIKLDAIVAEG---DVKLQRKMQVKRVQNYVETLDALKVK... 176
14 -9.6502d9d_A mol:protein length:89 BAG family molecular chaperone regulator 5  ali model follow..  23  43...............................................................LQGLIGQLDEVSLEKN---IREARRRAVIEVQTLITYID........ 80

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35