current user: public

If you have questions about the server, please let us know.

Query: d4i0va_ a.1.1.1 (A:) automated matches {Synechococcus sp. [TaxId: 32049]}, from SCOP207

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVQHRNDVLNRLast
1 -71.4002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  100  1ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVQHRNDVLNR 123
2 -69.3001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  59  2STLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAPAHKRDVLNQ 124
3 -64.1006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  38  1STLHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFRGVDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLIINRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGV--RPLFDPE 121
4 -63.6004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  43  8DSLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFANVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASA--RPLIFGT 128
5 -61.0002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  15  2.TFYEAVGGEETFTRLARRFYEGVAADPVLRPMYPEEDLGPAEERLRLFLMQYWGGPRTYSERRGHPRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYAAY--AMVNV 121
6 -60.2003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  47  5QTIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNTDMDHQTKQQTDFLTMLLGGPNHYKGKNMTEAHKGM----NLQNLHFDAIIENLAATLKELGVTDAVINEAAKVIEHT--RKDMLGK 121
7 -59.7002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  32  13ISIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFSGTNMSRLKGKVVEFFAAALGGPEPYTGAPMKQVHQGR----GITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPL--AVDVTSG 129
8 -59.5001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  34  13ISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGAPMKQVHQGR----GITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPL--AVDVTSG 129
9 -59.1001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  32  1.SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGRNLKEVHANM----GVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETV--RGDVVT. 115
10 -58.7004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  17  22KTPYEILGGEAGALAIANRFYDIMATDEYAKPLYDPLPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQDLRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLAS--HMINQ 144
11 -58.1001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  47  43SSLFAKLGGREAVEAAVDKFYNKIVADPTVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGKDMRTAHKDL--VPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVAST--RTEVLNM 161
12 -57.6005d1v_A mol:protein length:127 Globin  ali model follow..  25  4PTIYEQIGGEATFRRIVDIFYARVEADPRLRHLFPA-DLEPGKEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPEPARSVMENYFRHAAQ--AMMNR 123
13 -57.2001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  17  3KSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASITLDDEHRRELLDYLEMA--AHSLVNS 126
14 -56.8002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  17  6VTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAPADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAF--HMQNQ 128
15 -56.2004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  15  34MTFYEAVGGEETFTRLARRFFEGVAADPVLRPMFPEEDLGPAEERLRLFLMQYWGGPETYSERRGHPRLRMRHEPYRIGAEERDRFLTHMRAAVDDLALPAHLEQQLWEYLVYAAY--AMVNV 154
16 -56.1005v3t_A mol:protein length:132 Globin  ali model follow..  16  6MTPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPD-DLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQ--HMVNT 125
17 -55.7002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  21  4QTLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPD-DLTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAH--HMVNT 123
18 -48.4001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  15  6NAPYEAIGE-ELLSQLVDTFYERVASHPLLKPIFPS-DLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTAR--HMVNQ 124
19 -47.6004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  18  25SNLFDKLGL-QTFINLSTNFYTRVYDDEEEWSIFSNSNKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDVDIDQDSKIKMMKFFRHTAF--FLVAG 147
20 -47.2004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  10  51SKKVYLAAGEELLRKLVEVHHENLMKSKIHYLFPSHEQLRSLVKRSADFVVEMCGGPPYYTLTRGEPKMRARHFSVTIDEKAREIWLACYKHALKDVHFPLSVLEEFWQWIESFSI--RMINR 172
21 -42.0002ig3_A mol:protein length:127 Group III truncated haemoglobin  ali model follow..  12  1..MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNAEWKEHKAKIGNFWAGMLLGEGDYNGQPLKKHLDLP----PFPQEFFEIWLKLFEESLNIVYNEE-MKNVILQRAQMIASH...... 116
22 -14.3004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  13  32.........VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQERLIQIQHTEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS......... 143
23 -14.3002w31_A mol:protein length:162 GLOBIN  ali model follow..  17  29.........ETNKERLADQFYDYLLGIPETAEFLKEDLLQKLKQTHQDWFVSLFAGSNRYIHNLQKHAHVRVGLNAHYVNVAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKI......... 138
24 -14.2004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  13  27.........VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQERLIQIQHTEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS......... 138
25 -14.2001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model follow..  17  20.............TGFFDDFYRHFLASPQIRAKFATTDMTAQKHLLRAGIMNLVMYARGMSDSKLRAGASHSRAALDIRPELYDLWLDALLMAVAEH.......................... 105
26 -13.9004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  11  74.........TTHQSELPGYFYEQMLQDEQAMLFLTHEQKSRLHGTLRQWIVSVFSMSQALIAQQKQEIHARIKIPIHLVLRGARHLRERLFVLLRQRPLDPEHKLFGQRLISET......... 187
27 -13.5001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  13  59.........QENIVNIVDAFYKNLDHESSLMDIINDHSVDRLKQTLKRHIQEMFAGVDEFIEKRNRSIHLRIGLLPKWYMGAFQELLLSMIDIYEASITNQQELLKAIKATTKI......... 168
28 -12.5004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  16  32.........TANKAALADYFYESMLADPNAAFFLSDQLKTKLHASMQDWLESVYAAA---FQRKVGEVHARIDIPVHLVTRGASALIRRICELLRDASLSAAQAAATCRYVADV......... 145
29 -12.0005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  14  34.........APHFPRLAEEFYDRILGHEGARTALGESQVGHLKVTMIAWLDELLGGPWDEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLARL--PPELERVRNALGKVLDLELAVM.. 153
30 -11.5002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  50.........EDQVEEILDTWYGFVGSHPHLLYYFTSPDLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNYPITATMKPFLARKGHTPEEVEKMYQAWFKA......... 177

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.