current user: public

If you have questions about the server, please let us know.

Query: d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}, from SCOP207

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst ANKTRELCMKSLEHAKVDTSNEARQDGIDLYKHMFENYPPLRKYFKSREEYTAEDVQNDPFFAKQGQKILLACHVLCATYDDRETFNAYTRELLDRHARDHVHMPPEVWTDFWKLFEEYLGKKTTLDEPTKQAWHEIGREFAKEINKLast
1 -39.200PF00042.22; GLB8_CHITH/9-115; Globin  ali follow..  13  1...QLALFKSSWNTVK--------HNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFAVHSGRIVGFFSEVIGLIGNPEALKTLIDGLASSHKARGIEKAQF........................................ 99
2 -11.300PF11563.8; F0XJU9_GROCL/20-199; Protoglobin  ali follow..  10  15SSTDIDHLVAGAKYI----KVLIPAVTNIVYRKLLQ-YDITARAFTSFEGPLDAVPAEDSPQILHRKMFLRAYLARLCSDPSQMTFWEYLDKVGMMHVGLGRAHPSLIQDVLTEAVLSHPRLSMGRKMGLVKALGKVIWIQNDLFAK 172
3 -8.900PF08897.11; D5WYH9_THIK1/5-137; Domain of unknown function (DUF1841 topsan)  ali follow..  2KDEVRQFFLSAWQRHRAGGVLTPLE---LIAADWMELHPEYHAELTDPQSANRDYAVEQGRTNPFLHLSMHLTIAEQVSIDQPPGIRQAFELLRSKRGEHEAH--HAIMECLGEMLWTAQRSGLPPDGA.................. 125
4 -7.700PF17784.1; G9N3W9_HYPVG/16-220; Sulfotransferase domain  ali follow..  54........LQLLKELTEGFVVTSDIPFFSFVPELCELYPDAQVVYV----KRDPKTWWRSMGAVASNAQTKFLSMLFWPVPGWRWSIGTATLAFFRTQRVYTDNDLESMERHMQSVIDSVPKDRLHIVRLEDGWAPLCKILDCPIPN 188
5 -6.360PF17938.1; A0A0F2RSS2_9RHOB/90-208; Tetracyclin repressor-like, C-terminal domain  ali follow..  9...........................VEFTYDFFDSNPLFVKILRNENLLEGRFIVETEVVRISSQPLIDAISRIIARGLAQGVFRH---GYDALQIYITIVALSAHHLNNGHTLTAIFGVDLLSPEWRSKRRAHAVSLV...... 119
6 -6.350PF08362.11; RUTR_ECOLI/70-212; YcdC-like protein, C-terminal region  ali follow..  14  2.RQILDIWLAPLKAFREDFAPAAIKEYIRLKLEVSRDYPQASRLFCM------EMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIWASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIR. 141
7 -6.070PF15929.5; J9JQP8_ACYPI/1-150; Myofilin  ali follow..  1......MLKQHFDMIGRNEPIQRKANSGQSYVRALKGSDDMRA-----PEITHYHTPGRGVFRPILSADYPTWPSYKSIYDDPKHPSDRINTPGYRYLPYGISPRNIYPHNYHSDRYPSYDHYHSEPYKALQDWTDHLDRMAEL... 138
8 -5.960PF14920.6; F7G3Z3_ORNAN/259-510; MDM2-binding  ali follow..  207........................................................EDHECFSACSQRLFEISKFYLKDLKTSRGLLEEMKKTANNNVKQVI............................................. 252
9 -5.610PF05823.12; Q9XUB7_CAEEL/32-181; Nematode fatty acid retinoid binding protein (Gp-FAR-1)  ali follow..  11  1.AEFKELIPAKVTEYLKSITTEEKAAIKEFIKSVMGGNKSVEELSADIK-------ERSPSLYAKVEKLDVLLRTKLAKLDAALALFGKVIAQGLSFRQQFHAGYQPTPEMVKKLFKGYIAEYKTLSENAKATITDEFPIVVEFFQH 140
10 -5.520PF11075.8; Q089B5_SHEFN/10-184; Protein of unknown function VcgC/VcgE (DUF2780 topsan)  ali follow..  46TEQSSALVGDVMSQLGLSQTQAEGGLGSLLFSQLSDSIPNADGLLAAVPALSSDSGMSG---------LLSQAGNLGSALQGSAMVYDAFEKLG---------ISKEYITPMVDIAKNYLQQSGG...................... 163

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 9 2 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Shiryaev SA, Ratnikov BI, Chekanov AV, Sikora S, Rozanov DV, Godzik A,Wang J, Smith JW, Huang Z, Lindberg I, Samuel MA, Diamond MS, Strongin AY. Cleavage targets and the D-arginine-based inhibitors of the West Nile virus NS3 processing proteinase. Biochem J. 2006 Jan 15;393(Pt 2):503-11.