current user: public

If you have questions about the server, please let us know.

Query: d1dlwa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]}, from SCOP207

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGRNLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVTVLast
1 -59.600PF01152.21; Q7CX73_AGRFC/7-127; Bacterial-like globin  ali follow..  24  1TLYEAIGGDATVRALTRRFYELMDTLPEAARCRAPADLSGSEAKFYDYLTGYLGGPPVYVEKMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQN. 121
2 -10.100PF11563.8; F0XJU9_GROCL/20-199; Protoglobin  ali follow..  14  30........KVLIPAVTNIVYRKLLQYDITARAFDSPQILHRKMFLRAYLARLCSDPSQMT-DKVGMMHVGLGRAHPHIGATLSLIQDVLTEASHPRLSMGRKMGLVKALGKVI... 163
3 -6.340PF11662.8; F6FTU5_ISOV2/25-98; Protein of unknown function (DUF3263 topsan)  ali follow..  15  1....................................ELSDRDREILAFERQWW----KYAGAKEQAVRELFGLSPTRYYQVLNALIDSPAALAHDPMLVKRLRRMRATRQRA.... 72
4 -6.260PF14028.6; C7QBX6_CATAD/12-341; Lantibiotic biosynthesis dehydratase C-term  ali follow..  20  6.VFYASSTRPLLTECVRPMVDGLVADGLVSGYF--------------FINYWLEGP-----------HLRLRLSMAAVDPVRRRASAAIEDF........................ 74
5 -5.990PF05861.12; Q882R4_PSESM/1-352; Bacterial phosphonate metabolism protein (PhnI)  ali follow..  1.MYVAVGGEQAIDNAHRLLANKRRGDTDIAEL----DVEQIRQQLPLAVARVMSEGSLYDPQLAALAIKQSAGDLVEAIFLLRAYRTTLTRFCASVPIDTSNMQLDRRLSATFKDV 112
6 -5.710PF02444.16; ORF3_HEVCH/1-114; Hepatitis E virus ORF-2 (Putative capsid protein)  ali follow..  20  31.LAAAVGGAAAVPAVVSGVTGLILS-PSQSPIFIQPTPSPPMSPLRPGLDLVFANPPDHSAP...................................................... 90
7 -5.670PF07128.12; Q7ARC0_YERPE/25-161; Protein of unknown function (DUF1380 topsan)  ali follow..  21  11LLREQYPAETPLNLIV--------SPADIEALADGMEYAVSEQDTRAVLARM--------DAIPEEQQLESGVSAGAVMDLIEQVKEAVPAVMVPADLLETLLTTAEQ........ 103
8 -5.620PF02348.19; NEUA_MOUSE/44-298; Cytidylyltransferase  ali follow..  12  2ALVLARGGSKGIVPLIGWVLRAALDAGVFQSVWVSTDHDEIENVAKQFGAQVHRRSSETSKDSSTSLDAIVEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSV 127
9 -5.570PF14491.6; C0ZFK7_BREBN/30-262; Protein of unknown function (DUF4435 topsan)  ali follow..  33.....SKGKEGVLKLFRLITGISEYDLIKTLYFVDRDFDELIDNPHIYETPC------YS--------ENLYTTKNTICRVLQREFQLDETDDDYYTALHAFSTHQSEFHDAMDQI 130
10 -5.540PF02211.15; Q2K6I5_RHIEC/1-218; Nitrile hydratase beta subunit  ali follow..  15  5...HDLGGQMGFGPVAPEKDEPCFHADWEKRALG--------------ITLSCGAFGAWTIDESRHARENIPLAASYYEIWIRGVETLLARHGF---TREELLSGHKLQDGA.... 101

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 8 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Jaroszewski L, Godzik A. Domain analysis of the tubulin cofactor system: a model for tubulin folding and dimerization. BMC Bioinformatics. 2003 Oct 10;4(1):46.