current user: public

If you have questions about the server, please let us know.

Query: d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}, from SCOP207

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst HEHCCSEEDHRIVQKQWDILWRDTESSKIKIGFGRLLLTKLAKDIPEVNDLFKRVDIEHAEGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQHEVREGVQKAHFKKFGEILATGLPQVLDDYDALAWKSCLKGILTKISSRLLast
1 -35.200PF00042.22; GLB8_CHITH/9-115; Globin  ali follow..  22  1........QLALFKSSWNTVKHN----------EVDILYAVFKANPDIQAKFPQFADSIKDSADFAVHSGRIVGFFSEVIGLIGNPEALKTLIDGLASSHKA-RGIEKAQFEEFRASLV.............................. 107
2 -8.690PF00502.19; APCD_SYNP2/6-160; Phycobilisome protein  ali follow..  9ELRYPSSGELSGIKNFLATGAVRIRIADNEKKIVDQAQKQLFSIHPEYRTSGGNAATTKQYNQCLRDYGWYLRLVTYGIL--AGDKDPIERIGLIGVKEMYNALGVPVPGMVDAIRCLKDAALGVLDSEEARIAAPYFDFITQAM.... 155
3 -8.150PF11563.8; F0XJU9_GROCL/20-199; Protoglobin  ali follow..  14....FSSTDIDHLVAGAKYIKVLIP------AVTNIVYRKLLQ-YDITARAFETRSTSAEDSPQILHRKMFLRAYLARLCSDPSQMTFW-EYLDKVGMMHV-GLGRAHPLHSLIQDVLTEAVLSHPRLSLVKALGKVIWIQNDLFAKW. 173
4 -6.820PF11075.8; Q089B5_SHEFN/10-184; Protein of unknown function VcgC/VcgE (DUF2780 topsan)  ali follow..  15  46.....TEQSSALVGDVMSQLGLSQTQAEGQTNLGENDFSQLSDSIPNADGLLAAVPALSSDSG-----MSGLLSQAGNLGSALQGSAMVYDAFEKL--------GISKEYITPMVDIAKNYLQQSGGDGTVDLLMKGLG.......... 175
5 -6.690PF16489.5; F1QBS8_DANRE/2108-2359; GPCR-Autoproteolysis INducing (GAIN) domain  ali follow..  10  1...................................................................RSRSLASLLQSATGHTYDVRTAYHLLASVLEHESLQQGFELTA-TDFNRNIIKAGSAILDPLNQEHWEKIQRS-TANLLHQF 91
6 -6.420PF16727.5; A0A194XQL3_9HELO/1150-1239; DNA repair protein REV1 C-terminal domain  ali follow..  17  1..............................................ELRDTLSAWHSEFVDDGPHPDDVAAMERYLRRVILDERDMSKVVNVVRWLAWLIDESDQ---------------------DNEGTRIWSEALEGIKFKVQAAV 82
7 -6.300PF16043.5; H3BA08_LATCH/112-317; Domain of unknown function (DUF4795 topsan)  ali follow..  14  10...................................HVQNAILLLQAECEKLNSTAGDLIEDHNKKQDDIDHLYETVEKLEEKKADKEIVDMEIDVKADKFALANKVSRTQFDSTTEQLGKMIQDLLSKVQEQDWQKVIEKISTEMECKL 125
8 -6.160PF01152.21; Q7CX73_AGRFC/7-127; Bacterial-like globin  ali follow..  1..................TLYEAIGGDATVRALTRRFYELM-DTLPEAARCRAI------HPADLSGSEAKFYDYLTGYLGGPPVYVE-----PMLRRRHFV-APIGPAERDEWLLCFRRAMDETENAKLREIIWAPVERLAFHMQN.. 121
9 -6.060PF17784.1; G9N3W9_HYPVG/16-220; Sulfotransferase domain  ali follow..  54.............LQLLKELTEGFVVTSD----FFSFVPELCELYPDAQVVYVKRDPKTWWRSMGAVASNAQTKFLSMLFWPVPGWRWSIGTATLAFFRTQRVYTDNLESMERHMQSVIDSVDRLHIVRLEDGWAPLCKILDCPI.... 186
10 -6.060PF08678.10; E6TV45_BACCJ/10-135; Rsbr N terminal  ali follow..  11  2.......QYKDAIIDQWLVEIRKFRKEDSLQNITDTMYENTNREFADK--LLSTVQNDNGEEEVLILFSERLIQPLNYITRGLQEFRKI--TVTTLSKQEADYYKSMEFFQEI--EDWIDSIVNILVNEYSGSWE.............. 126

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.