current user: public

If you have questions about the server, please let us know.

Query: d1x9fd_ a.1.1.2 (D:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}, from SCOP207

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst ECLVTESLKVKLQWASAFGHAHERVAFGLELWRDIIDDHPEIKAPFSRVRGDNIYSPEFGAHSQRVLSGLDITISMLDTPDMLAAQLAHLKVQHVERNLKPEFFDIFLKHLLHVLGDRLGTHFDFGAWHDCVDQIIDGIKLast
1 -37.700PF00042.22; GLB8_CHITH/9-115; Globin  ali follow..  18  1.....QLALFKSSWNTV-------KHNEVDILYAVFKANPDIQAKFPQFADSIKDSADFAVHSGRIVGFFSEVIGLIGNPEALKTLIDGLASSHKARGIEKAQFEEFRASLV............................ 107
2 -9.200PF11563.8; F0XJU9_GROCL/20-199; Protoglobin  ali follow..  10  13DFSSTDIDHLVAGAKYI---KVLIPAVTNIVYRKLLQ-YDITARAFPLDAVPAEDSPQILHRKMFLRAYLARLCSDPSQMTFW-EYLDKVGMMHVGLGRAHPLHSLIQDVLTEAVLSHPRL--SMGRKMGLVKALGKVI. 163
3 -8.260PF08897.11; D5WYH9_THIK1/5-137; Domain of unknown function (DUF1841 topsan)  ali follow..  17  2..KDEVRQFFLSAWQRHR--AGGVLTPLELIAADWMELHPEYHAELTDPQSNRDYAVEQGRTNPFLHLSMHLTIAEIDQPPGIRQAFELLRSKRGEHEAHHAIMECLGEMLWTAQRS--GLPPDGAAYVDCVQ....... 132
4 -7.640PF01152.21; Q7CX73_AGRFC/7-127; Bacterial-like globin  ali follow..  9....................DATVRALTRRFYELM-DTLPEAARCRAI------HPADLSGSEAKFYDYLTGYLGGPPVYVE-----PMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHM. 119
5 -7.470PF16727.5; A0A194XQL3_9HELO/1150-1239; DNA repair protein REV1 C-terminal domain  ali follow..  1........................................ELRDTLSAWHSEFVDDGPHPDDVAAMERYLRRVILDERDMSKVVNVVRWLAW---------------------LIDESDQDNEGTRIWSEALEGIKFKVQ 79
6 -7.010PF14361.6; E6VWZ1_PSEA9/5-105; RsbT co-antagonist protein rsbRD N-terminal domain  ali follow..  16  1NELAARRAELSEKW-----------------ADLVLQSYPKETQKIWGRQKDRFQNP-VGAAIVEATRELFDHMLDWKDAEKIAASLDTLIRIRSVQDFSPSQAISFVFLLKKLLRDEF..................... 101
7 -6.730PF11865.8; Q7S6V7_NEUCR/738-897; Domain of unknown function (DUF3385 topsan)  ali follow..  11  5...................................YLEYPQLLEILQSIIRGEPQHGTLRQETIKLMGILGALEERTDDNKRNNEAAQLTDVSLMMGGLTPSNEDYYPTVVINALLQILKDQSLVQWHGNVVDAIMSIFI 116
8 -6.590PF06227.12; Q08FJ5_DPV83/1-130; dsDNA Poxvirus  ali follow..  10  12..EKNIVDILKYTWRGSSDFYDKHDC---KIFKKLMLFDDNARKIMGDYDYLFIKNMNLSLDDGPRLDKIDSNILSKLSYKELIGVCAVLAEKVVHYPYTIKWEKVFNTLFNRLTNEDLME................... 130
9 -6.540PF01401.18; F1NYM0_CHICK/629-1207; Angiotensin-converting enzyme  ali follow..  10  17TAEVVWNAYTEASWEYNTNITDHNKEVMLEKNLAMSKHTIEYGMRARQFDPSDFQDETVTRILNKLSVLERAALPE-DELKEYNTLLSDMETTYSVAKVCREN-HPLDPDLTDILATSRDYNELLFAWKGWRDASGAKIK 157
10 -6.520PF05194.12; UREE_RHOFT/78-166; UreE urease accessory protein, C-terminal domain  ali follow..  24  13.............................................................................GTAFDLTRAAYHLGNRHVPIELKPDHLKIEPDHVLADMLRAMHLTVLAVN............. 62

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 8 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Jaroszewski L, Godzik A. Domain analysis of the tubulin cofactor system: a model for tubulin folding and dimerization. BMC Bioinformatics. 2003 Oct 10;4(1):46.