current user: public

If you have questions about the server, please let us know.

Query: d3ldqb1 a.7.7.1 (B:151-260) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst NSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQLast
1 -25.900PF02179.16; S3DBF8_GLAL2/214-294; BAG domain  ali follow..  20  1.....................IQAISSHFHTKILPLCVQYTISPPEDP--KKRDFEHKKLSETIMEVLLKLDAVETEGD-NEARERRRALVKETQGVLNGLDA....... 80
2 -8.400PF09787.9; W4YU02_STRPU/423-727; Golgin subfamily A member 5  ali follow..  14  126............EELHRQRLDLQAKIKDREDDIQRLRNQLKTKSMSSSSETELEGRLHALTESLIQKQTMLETLSSEKNSLGLQLER....................... 200
3 -7.050PF15027.6; G1PG95_MYOLU/3-140; Domain of unknown function (DUF4525 topsan)  ali follow..  30.......................................YTFQQPRHQSSVKLREQILDLSKRYVKALAEENKNTMDVSMAGYADLKRTIAVLLDDILQRLVKLENKVDY 104
4 -6.440PF10768.9; Q89I02_BRADU/1-135; Class II flagellar assembly regulator  ali follow..  17  49................................................................IDALLALQGIE-----EDPVERRKRSVARGRTALDVLDDLKMGL.. 87
5 -6.390PF05757.11; M1BYS2_SOLTU/31-230; Oxygen evolving enhancer protein 3 (PsbQ)  ali follow..  10  97.....AEAVQRVKDSAKEIVSVKNFIDKLRLRAEYLRYDL--KTVISAKPKEQKGKLQDLSGKLFKTISDLDHAAKTKNSDEAQKYYAETVTTLNDVLANL......... 199
6 -6.020PF06657.13; G3JQ94_CORMM/870-946; Centrosome microtubule-binding domain of Cep57  ali follow..  18..................................................KGLEDESRHLQFELSQLQTKYSNQDKAIG----KRDRVALAEDIRSLLKRLEVKNDQI.. 71
7 -5.920PF15960.5; Q4V3S3_DROME/9-228; Domain of unknown function (DUF4763 topsan)  ali follow..  23.DPSDAEEETDLDAAYDELEEMKQRLITLRNKIIITNPDACQDLKIRDLWTPEGGELQELRDQKCQLICQLQEATQHLKDSQNELKEQLRIHQAKRQLSQFENFKLKVIH 139
8 -5.750PF08064.13; ATR_CANGA/887-989; UME (NUC010) domain  ali follow..  1..........................................................NLQDNILGIFQVFSSDMHDVEGKTTYYEKLRVINGISFLVKHASN....... 45
9 -5.720PF10148.9; F1QGH1_DANRE/12-242; Schwannomin-interacting protein 1  ali follow..  11  179..................................................NDLHSQIQGLNEELVQLLLMRDEL---------HMEQDAMLVDVEDLTRHAHSQQRHMME 229
10 -5.710PF15460.6; K1XZH4_MARBU/283-379; Something about silencing, SAS, complex subunit 4  ali follow..  16  35.............................................................DQVIRILESLQGHDTESKKKEYEPARDYFIKGCETILEKFRIWREEEKR 93

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35