current user: public

If you have questions about the server, please let us know.

Query: d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst PPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPLast
1 -86.300d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors  100  1PPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATP 136
2 -53.000d3kx2a1 c.37.1.19 (A:1-270) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 559292]}  ali model 3D-neighbors follow..  20  104..KLYQNNQIMVFVGETGSGKTTQIPQFVLFENTQVACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENTILKYMTDGMLLREEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSAT. 249
3 -45.700d5y4za1 c.37.1.14 (A:178-481) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}  ali model 3D-neighbors follow..  20  4.PSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIRTVILAPTRVVAAEMEEALRGLPVRYMTTAVN-VTHSGTEIVDLMCHATFTSRQPIRVPNYNLNIMDEAHFTDPSSIAARGYISTRVE-MGEAAAIFMTATP 142
4 -45.300d1yksa1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}  ali model 3D-neighbors follow..  19  1...MLKKGMTTVLDFHPGAGKTRRFLPQILRRRLRTLVLAPTRVVLSEMKEAFHGL-DVKFHTQAFSAHGSGREVIDAMCHATLTYREPTRVVNWEVIIMDEAHFLDPASIAARGWAAHRAR-ANESATILMTATP 137
5 -26.000d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  23  84......VDKRGCIVLPTGSGKTHVAMAAINELSTPTLIVVPTLALAEQWKERLGIFGEEYVGEFSGRIK--ELKPLTVSTYDSAYVNAEKLGNRFMLLIFDEVHHLPAES------YVQIAQMSIAPFRLGLTATF 205
6 -25.100d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  14  127......VNRRRILNLPTSAGRSL-ARYYLENYEGKILIIVPTTALTTQMADDFVDMIKKIGGGASKDDKYKNDAPVVVGTWQTVVKQPKEWFSQFGMMMNDECHLATGKSISSI-----ISGLNNCMFKFGLSGSL 262
7 -21.600d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  20  23.......ETNCLIVLPTGLGKTMIAEYRLTKYGGKVLMLAPTKPLVLQHAESFRRLFNLPPEKIVALSKAWARAKVIVATPQTILLAGRISLEDVSLIVFDEAHRAVGNYAYV--IAREYKRQAKNPLVIGLTASP 166
8 -20.100d1gkub1 c.37.1.16 (B:6-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  16  52......RKESFAATAPTGVGKTS-MSLFLALKGKRCYVIFPTSLLVIQAAETIRK--RIPKREKENFMQNLRNFKIVITTTQF-LSKHYRELGHFDFIFVDDVDKASKNVDKLLHLLTKSWVGEARGCLMVSTAT. 208
9 -18.600d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  22  39......SGKNLLLAMPTAAGKTLLAEMAMVRKGGKSLYVVPLRALAGEKYESFKKKIGLRIGISTGDYESLGDCDIIVTTSDSLIRNRASWIKAVSCLVVDEIHLLDSEK-TLEILVTKMRRMNKALRVIGLSAT. 181
10 -16.900d2z0ma1 c.37.1.0 (A:1-192) automated matches {Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  20  26..PLMLQGKNVVVRAKTGSGKTAAYAIPILELGMKSLVVTPTRELTRQVASHIGRYMDTKVAEVYGGMPRVRNADIVVATPGRLLSKGVIDLSSFEIVIIDEADLMEMGFIDDIKIILAQTSNRKITGLFSATIPE 172
11 -16.900d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  16  108...........LLQGDVGSGKTVVAQLAILEAGFQTAFMVPTSILAIQHYRRTVEKFNIHVALLIGATTPLRNGQIDVVIGTHALIQEDVHFKNLGLVIIDEQHR------FGVKQREALMNKGKMVDTLVMSATP 241
12 -16.800d2pl3a1 c.37.1.0 (A:47-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  59......QGKDVLGAAKTGSGKTLAFLVPVLEAGLGVLIISPTRELAYQTFEKVGKNHDFSAGLIIGGKERINNINILVCTPGRLLQHMDEHATDLQMLVLDEARILDMGFADTMNAVIENLPKKRQTLLFSATQTK 212
13 -16.500d3peya1 c.37.1.0 (A:91-286) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  14  34PLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTR--QAICLAPSRELARQTLEEMGKFTKITSQLIVPDSFEKNNAQVIVGTPGTVMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSAT. 183
14 -15.600d3dkpa1 c.37.1.0 (A:139-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  59..PVMLHGRELLASAPTGSGKTLAIPILMQNKGFRALIISPTRELASQILIKISEGTGFRIHMIHKAAVAAKKFDILVTTPNRLIDPPGIDLASVEWLVVDESDKLFEDGKTGFRDQLASI-TSHKVRRAMFSAT. 217
15 -15.500d2oxca_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  39........LDLIVQAKSGTGKTCVFSTIALDSSTQILILAPTREIAVQIHSVITAIGIKMEGLECQDKTRLKKCHIAVGSPGRIIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSAT. 184
16 -15.300d3bera_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  50......QGRDIIGLAETGSGKTGAFALPILNARLFALVLTPTRELAFQISEQLGSSIGVQSAVIVGGLALAKKPHIIIATPGRLINTKGFNLRALKYLVMDEADRINMDFETEVDKILKVIPRDRKTFLFSATMTK 200
17 -14.700d3iuya1 c.37.1.0 (A:213-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  51..PIILQGIDLIVVAQTGTGKTLSMPGFIHRNGPGMLVLTPTRELALHVEAECSKYSYKGLKSICIYEDISKGVDIIIATPGRLQMNNSVNLRSITYLVIDEA-DKMLDMEFEPQIRKILLDVRPDRQTVMTSAT. 206
18 -14.600d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  37......LGMDVLCQAKSGMGKTAVFVLATLQQ--SVLVMCHTRELAFQISKEYERFSKYMPNVKV--VLKKNCPHIVVGTPGRILRNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSAT. 186
19 -14.500d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  17  46......EGHDVLAQAQSGTGKTGTFSIAALQR--QALMLAPTRELALQIQKVVAFHMDIKVHACIGGTSGLRDAQIVVGTPGRVIQRRRFRTDKIKMFILDEADEM-LSSGFKEQIYQIFTLLPPTTQVVLLSAT. 191
20 -14.400d5gvra_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  45..PTILSGRDMIGIAFTGSGKTLVLPVIMFREGPYGLIICPSRELARQTLEYYCRLLQEDSSPLLRCALCIGGMSMMVATPGRLLQKKMVSLDICRYLALDEA-DRMIDMGFEGDIRTIFSYFKGQRQTLLFSAT. 209
21 -14.000d2i4ia3 c.37.1.0 (A:168-406) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  45..PIIKEKRDLMACAQTGSGKTAALPILSQKQYPISLVLAPTRELAVQIARKFSYRSRVRPCVVYGGADI-RGCHLLVATPGRLMERGKIGLDFCKYLVLDEA---DRMLDMGFEPQIRRMPPKGVRHTMMFSAT. 217
22 -13.900d3mwja_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}  ali model 3D-neighbors follow..  17  37......EGKDLIGQARTGTGKTLAFALPIAERKPRALVLTPTRELALQVASELTAAVYGGTGYGKQKEALLRGADAVVATPGRALRQGVLDLSRVEVAVLDEADEMSMGFEEEVEALLSATPPSRQTLLFSATLPS 187
23 -13.900d4ct4b1 c.37.1.0 (B:95-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  38......SGRDILARAKNGTGKSGAYLIPLLERNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVDIMRLDDTVHVVIATPGRILKKGVAKVDHVQMIVLDEADKLSQDFVQIMEDIILTLPKNRQILLYSATFPL 188
24 -13.800d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  14  33..PGALRGESMVGQSQTGTGKTHAYLLPIMEK--QAVITAPTRELATQITKFCPKDRMIVARCLIGGEKLNVQPHIVIGTPGRIIREQALDVHTAHILVVDEADLM-----LDMGFITDVARMPKDLQMLVFSAT. 187
25 -13.600d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  80...........LVCGDVGFGKTMRAAFLAVDNHKQVAVLVPTTLLAQQHYDNFRDRFARSAKEQTQILAEVAEGKIDILIGTHKLLQSDVKFKDLGLLIVDEEHR------FGVRHKERIKAMRANVDILTLTATP 213
26 -13.500d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  20  50.....GVFRAAMLYGPPGIGKTTAAHLVAQELGYDILEQNASDVRSKTL---------------LNAGVKNALDNMSVVGYFKHNEEAQNLNGKHFVIIMDEVDGMSGGDRGGVGQLAQFCRKTSTPLILICN... 162
27 -13.300d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  15  1......ERGIIIVFTGNGKGKTTGTAARAVGHGKNVGVVQFIKGTWPNGERNLLEPHGVEFATGFTWETQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGHQTVIITG.. 134
28 -12.800d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  158..AVALTRRISVISGGPGTGKTTTVAKLLAGERCRIRLAAPTGKAAARLTESLGKALRDEQKKRIPEDASTLHRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLP---MMSRLIDALPDHARVIFL...... 294
29 -12.700d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  12  3..........IIITGEPGVGKTTLVKKIVERLGKRAIGFWTEEVITTEGKKKIFSSKFFTSKKLVGSYGVNVQYFEELAIPILERAYREAKKDRRKVIIIDEIGKMELFSKKFRDLVRQIMHDPNVNVVATIPIR. 140
30 -12.700d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  16  35...........CLADDMGLGKTLQTIAVFSDAKKESLVICPLSVLKEEELSKFAPHLRFAVFHEDRSKIKLEDYDIILTTYAVLLRDTRLKEVEWKYIVIDEAQNIKNPQTKIFKAVKELKSKYR----IALTGTP 162
31 -12.700d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]}  ali model 3D-neighbors follow..  15  2........RQVAIYGKGGIGKSTNLTSGLHAMGKTIMVVDPKADSTRLLLGGLAQKSVLDTLREEGEDVELDSGGIRCVESGNMLEQLGAYTDDLDYVFYD------VLGDVVCGGFAMPIREGKAQEIYIVASG. 150
32 -12.200d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  2........RHVFLTGPPGVGKTTLIHKASRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVP. 146
33 -12.000d2gk6a1 c.37.1.19 (A:295-324,A:416-702) Upf1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  100......QRPLSLIQGPPGTGKTVTSATIVYHGNGPVLVCAPSNIAVDQLTEKIHQT------VRLCAKSRLMNADVICCT---CVGAGDPRLAKFRSILIDESQATEPECMVPVVLGAKQLILVGDHCQL...... 282
34 -12.000d3enda_ c.37.1.0 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}  ali model 3D-neighbors follow..  19  3........KVFAVYGKGGIGKSTNLSAAFSILGKRVLQIDPKHDSTPTVIDVLKDVDFHPEELRPEDFVFEGFNGVMCVEAGVKLLKQHHLLDDTDVVIFD------VLGDVVCGGFAAPLQHADQAVVVTAN... 150
35 -11.900d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  12  3........KIILTIGCPGSGKST-WAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKG----------VIISDTNLNPERRL-----WETFAKEYGWKVEHKVFDVP 115
36 -11.900d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}  ali model 3D-neighbors follow..  17  11........NLWFLVGLQGSGKTTKLALYYKGKGRRPLLVDTQRPAAREQLRLLGEKVGVPV-----LEVMDGESPESIRRRVEEKARL----EARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAM. 133
37 -11.800d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  19  3..........IAIEGVDGAGKRTLLSGAFRAAGRSVATLAPQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHT-------QGLCRGYDVVILDRYVASNA............................ 101
38 -11.600d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebrafish (Danio rerio) [TaxId: 7955]}  ali model 3D-neighbors follow..  16  83...........IMADEMGLGKTLQCITLIWTL-DKVIVVSPSSLVPVAIDGGSKDEIDSKLVNFISQQGMRIPTPILIISYETFRLHAEVLHKKVGLVICDEGHRLKNSDNQTYLALNSMNAQRR----VLISGTP 230
39 -11.600d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  39......SGRDCLVVMPTGGGKSLQIPALLLN----TVVVSPLISLMKD-AACLNSTQTREQQLEVMTGCRTGQIRLLYIAPERLMLDNFLEH-NPVLLAVDEAH-HDFRPEYAALGQLRQRFPTLPFMALTATADD 186
40 -11.400d1khta_ c.37.1.1 (A:) Adenylate kinase {Methanococcus voltae [TaxId: 2188]}  ali model 3D-neighbors follow..  10  1.......NKVVVVTGVPGVGSTTLAMDNLRKEGVNYKMVSFGSVMFEVAKEE---------NLVSDRDQMRKMDPETQKRIQKMAGRKIAEMAKESPVAVDTHSTVSTPKGYLPGLPSWVLNELNPDLIIVVETTG 123
41 -11.300d1w4ra1 c.37.1.24 (A:18-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  1......RGQIQVILGPMFSGKSTEL-RRFQIAQYKCLVIKY------AKDTRYSSSFCTHDRNTMEALPACLLRDVA------------QEALGVAVIGIDEGQ................................ 83
42 -11.200d1nksa_ c.37.1.1 (A:) Adenylate kinase {Sulfolobus acidocaldarius [TaxId: 2285]}  ali model 3D-neighbors follow..  15  2........KIGIVTGIPGVGKSTKVKEILDNQGINNKIIN----YGDFMLATALKLGYAKDRDEMRKLSVEKQKKLQIDAAKGIAEEARA--GGEGYLFIDTHAVIRTPSGYLPGLPSYVITEINPSVIFLLEADP 126
43 -11.000d1yj5a2 c.37.1.1 (A:351-522) 5` polynucleotide kinase-3` phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  14  4PESSSPNPEVVVAVGFPGAGKSTFIQEHLVSAGY-------VHVNRDTLGSWQRCVSSCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVPCRCFNFC................................... 100
44 -10.500d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  12  36..........LLLYGPNGTGKKTRLLESIFGPGVYRLKIDVRQFVTASNRKLELNVVSSPYHLEITPSDMGNNDRIVIQEL-DFQDSKDGLAHRYKCVIINEANSLTKDAQAALRRTMEKYSKNIRLIMVCDSMS. 172
45 -10.300d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  17  5........NILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWGYIKHGRIDPWLPQSHQQNRMIMQIAADVAGRYAKEGY--------------VILDGV................................. 86
46 -10.100d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  13  5.........ISIVSGKGGTGKTTNLSVALGDRGRKVLAVDGDLTMANLSLVLGVDDPDVTLHDVLAGEANVEDAIYMTQFDNVYVLPGAVDWEHFDFILID--------CPAGLQLDAMSAMLSGEEALLVTNPEI 145
47 -9.770d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  13  8........KTVAILGGESSGKSV-LVNKLAAVFNTTSAWEYGREFVFEKLGGDEQAM--------------QYSDYPQMALGHQRYIDYAVRHSHKIAFIDT.................................. 86
48 -9.750d4v03a_ c.37.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  16  4.........IVITSGKGGVGKTTNIGTALAKLGKKVLLIDRNLDMILGLENRIVYDILRGLSLWLLPANQRANKDVIDIEKWNKTVEEIKNSGNYDYILVD--------SPAGIEKGFQIAVSPADKALIVVNPEV 147
49 -9.730d2vp4a_ c.37.1.1 (A:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  19  7.....TQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEP............................................................................................... 42
50 -9.730d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  4...LQNIPPYLFFTGKGGVGKTSATAIRLAEQGKRVLLTDPASNVGQVFSQTIGNTLEIDPQAAAQQYRARIVDPIKGVLPDDVVSSINEQLTRFDHIIFDTAPTGHTIRLLQL...................... 155
51 -9.700d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  13  48..........LLFAGPPGVGKTTALARELFGENWRHNFLELNASDERGINVIREK---------------------------EFARTKPIGGASFKIIFLDEADALTQDAQQALRRTMEMFSSNVRFILSCNYSS. 150
52 -9.600d1e2da_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  1.....RRGALIVLEGVDRAGKSTQLVEALCAAGHRAELLR--------------FPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANKEKLSQGVTLVVDRYAFSGV............................ 100
53 -9.470d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}  ali model 3D-neighbors follow..  29  3........KLYIITGPAGVGKST-TCKRLAAQLDNSAYIE................................................................................................ 33
54 -9.430d3kb2a1 c.37.1.1 (A:2-165) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  20  1........TLIILEGPDCCFKST-------------------------VAAKLSK--------ELKYPIIKGSSFELAKSGNEKLFEHFNKLADEDNVIIDRFVYSNL............................ 67
55 -9.350d2yhsa2 c.37.1.10 (A:285-495) automated matches {Escherichia coli K-12 [TaxId: 83333]}  ali model 3D-neighbors follow..  15  11.........VILMVGVNGVGKTTKLARQFEQQGKSVMLADTFRAAAVEQLQVWGQRNNIPV-----IAQHTGADSASVIFDAIQAAKA----RNIDVLIADTAGRLQNKSHLM-RVMKKLDVEAPHEVMLTIDAS. 138
56 -9.350d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  15  38..........VLLAGPPGLGKTT-------------------------LAHIIASELQTNIHVTSGPVLVKQGDMAAILTS----------LERGDVLFIDEIHRLNIDIMIGKGPSAKSIRIDIQPFTLVGATT. 142
57 -9.250d2yoga_ c.37.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}  ali model 3D-neighbors follow..  10  3.....KKGKFIVFEGLDRSGKSTQLVEYLKNNNVEVKHLY--------------FPNRETGIGQIISKYLKMENSMSNETIHLLFSANKSLLLKGIWVVCDRYAYSGV............................ 102
58 -9.240d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]}  ali model 3D-neighbors follow..  17  10..LVDVYGVGVLITGDSGIGKSE-TALELIKRGHRLV................................................................................................... 43
59 -9.200d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  37...LSPQRRMLIITGPNMGGKSTYMRQLMAYIGSYV----PAQKVEIGPIDRIFTRVGAADDLASGRS--------TFMVEMTETANILHNATEYSLVLMDEIGRGTSTYD......................... 137
60 -9.140d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}  ali model 3D-neighbors follow..  15  30.....ESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQNFDELVKLYEKDVVKHVTPYSNRMTEAIISRLSD-----------QGYNLVI-----EGTGRTTDVPIQTATMLQAKGYETKMYVMAVP 146
61 -9.100d3tqfa_ c.91.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}  ali model 3D-neighbors follow..  14  8..FLVIDKMGVLITGEANIGKSE-LSLALIDRGHQLV................................................................................................... 41
62 -9.100d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  23......DELVTTLSGGNGAGKSTTMAAFVT-----ALIPDLTLLHFRNTTEAGATSGSRDKGLHGKLKAGVCYSMLDTINS....................................................... 92
63 -9.020d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  20....IETGSITEMFGEFRTGKTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSA-ARQMHLARFLRMLLRLADEFGVAVVITNQVV. 173
64 -9.010d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  30........PITLVLGLRRTGKSSIIKIGINELNLPYIYLDLRKFLQKEINKLVKRLPSLLKALKNIQGIVIMGNEIKFNWNRKDRLSFANLLESFEIIVLDEAQEVKLRGVNLLPALAYAYDNLKRIKFIMSGSE. 178

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.