current user: public
If you have questions about the server, please let us know.

Query: d1b74a1 c.78.2.1 (A:1-105) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MKIGIFDSGVGGLTVLKAIRNRYRKVDIVYLGDTARVPYGIRSKDTIIRYSLECAGFLKDKGVDIIVVACNTASAYALERLKKEINVPVFGVIEPGVKEALKKSRLast
1 -69.100d1b74a1 c.78.2.1 (A:1-105) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]}  ali model 3D-neighbors  100  1MKIGIFDSGVGGLTVLKAIRNRYRKVDIVYLGDTARVPYGIRSKDTIIRYSLECAGFLKDKGVDIIVVACNTASAYALERLKKEINVPVFGVIEPGVKEALKKSR 105
2 -14.000d2zska1 c.78.2.0 (A:1-114) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}  ali model 3D-neighbors follow..  24  4..IGI----IGGTTYIEISREKFEKYFIIYSINFKEFFQNPEGWEGRKKILINAAKALERAGAELIAFAANTPHLV-FDDVQREVNVPMVSIIDAVAEEILKR.. 113
3 -13.200d1jfla1 c.78.2.1 (A:1-115) Aspartate racemase {Pyrococcus horikoshii OT3 [TaxId: 70601]}  ali model 3D-neighbors follow..  25  4..IGIL-GGMGPLATAELFRRIVIKTPAKRDQEHPKV---LGKGEDPRPQLIWTAKRLEECGADFIIMPCNTAHAF-VEDIRKAIKIPIISMIEETAKKVKEL.. 114
4 -12.500d5hqta1 c.78.2.0 (A:1-116) automated matches {Escherichia coli [TaxId: 1330457]}  ali model 3D-neighbors follow..  15  4..IGL----LGGMSINEGIKQRLGGLHSAQV-HEIEECQRRGEWDKTGDILAEAALGLQRAGAEGIVLCTNTMHKV-ADAIESRCTLPFLHIADATGRAITGA.. 115
5 -8.430d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  9  2PQICVVGSGPAGFYTAQHLLKHHSRAHVDIY-EKQLVPFGVAPDHPEVKNVINTFTQTARSDRCAFYGNVEVGRDVTVQELQDAYHAVVLSY............. 97
6 -8.000d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  19  2MKLMFASDIHGSLPATERVLELFAQSGLVILGDVLN--HGPRNALPEGYAPAKVVERLNEVAHKVIAVRGN.................................. 73
7 -7.540d1jfla2 c.78.2.1 (A:116-228) Aspartate racemase {Pyrococcus horikoshii OT3 [TaxId: 70601]}  ali model 3D-neighbors follow..  16  4.........AGLLATTGTIVSGVYEKEFSKYGVEIMTPTEDEQKKLGRELLLKTAKILEERGAECIIAGC---TEVSVVLKQDDLKVPLIDPMDVIAEVAVKVA. 110
8 -7.230d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  16  13.......PGSGKSTIAEALANLPGVPKVHFHSDDLWLPQSHQQNRMIMQIAADVAGRYAKEGYF--VILDGVVRPDWLPAFTALARPLHYIVLRTTAAEAIERCL 119
9 -7.200d5hqta2 c.78.2.0 (A:117-230) automated matches {Escherichia coli [TaxId: 1330457]}  ali model 3D-neighbors follow..  14  51.......................................LGQFTEASRAYYAQVIARLAEQGAQGVIFGC---TEIGLLVPEERSVLPVFDTAAIHAEDAVAFM. 112
10 -7.180d3orsa1 c.23.8.0 (A:1-160) automated matches {Staphylococcus aureus [TaxId: 426430]}  ali model 3D-neighbors follow..  19  1MKVAVIMGSSSDWKIMQESCNMLDYFEIPY---EKQVVSAHRTPKMMVQFASE----ARERGINIIIAGAGGAAHLP-GMVASLTTLPVIGV............. 84
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 9 4 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.