current user: public
If you have questions about the server, please let us know.

Query: d1bdsa_ g.9.1.1 (A:) BDs-I defensin {Sea anemone (Anemonia sulcata) [TaxId: 6108]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPHLast
1 -35.400d1bdsa_ g.9.1.1 (A:) BDs-I defensin {Sea anemone (Anemonia sulcata) [TaxId: 6108]}  ali model 3D-neighbors  100  1AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH 43
2 -7.130d1ahla_ g.9.1.1 (A:) Anthopleurin-A {Giant green sea anemone (Anthopleura xanthogrammica) [TaxId: 6112]}  ali model 3D-neighbors follow..  27  1GVSCLCDGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCC... 47
3 -5.530d2bjqa2 b.169.1.1 (A:5-174) Sperm motility protein MFP2 {Pig roundworm (Ascaris suum), isoform A [TaxId: 6253]}  ali model 3D-neighbors follow..  21  36......FGKPIHGRAWNDNGNVECSFPYNKVELTGARD..... 67
4 -4.940d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  24  67..........QQGEHIRFFSDQPHGYAAVTEKAVFQNIVAYPR 99
5 -4.870d3es6b1 b.1.18.23 (B:1-118) Prolactin-inducible protein, PIP {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  59.TACLCDDNPKT--YWDFYTNRTVQIAAVVDVIRELGIC.... 95
6 -4.820d1bgka_ g.19.1.1 (A:) Sea anemone toxin k {Sea anemone (Bunodosoma granulifera), BGK [TaxId: 31164]}  ali model 3D-neighbors follow..  35  18...................GNCRTSQKYRANCAKTCELC.... 37
7 -4.780d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  21QLICNVTGQLSDIAYWKWNGS...................... 41
8 -4.630d2iepa1 b.1.1.0 (A:24-118) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  15  23TFMCAVESYPQPEISWTRNK....................... 42
9 -4.600d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  15KLNCSVEGMEEPDIQWVKDGA...................... 35
10 -4.510d2xy1a2 b.1.1.0 (A:301-398) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  19TLVCDAEGEPIPEITWKRAVD...................... 39
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.