current user: public

If you have questions about the server, please let us know.

Query: d1d5ya2 a.4.1.8 (A:57-121) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst RRLSKSAVALRLTARPILDIALQYRFDSQQTFTRAFKKQFAQTPALYRRSPEWSAFGIRPPLRLGLast
1 -45.200d1d5ya2 a.4.1.8 (A:57-121) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors  100  1RRLSKSAVALRLTARPILDIALQYRFDSQQTFTRAFKKQFAQTPALYRRSPEWSAFGIRPPLRLG 65
2 -42.600d1bl0a2 a.4.1.8 (A:63-124) MarA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  37  1RKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPL... 62
3 -8.840d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  21  18............SPLSLEKVSERSGY-SKWHLQRMFKKETGHSLGQYIRS............... 54
4 -7.270d2d28c1 d.52.10.1 (C:1-149) Type II secretion ATPase XpsE {Xanthomonas campestris [TaxId: 339]}  ali model 3D-neighbors follow..  23TDLVRARQLQAESGMGLLALLGRLGLVSERDHAETCAEVLGLP...................... 65
5 -5.530d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  9AALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKP...................... 51
6 -5.490d1ufza1 a.5.9.1 (A:8-77) HBS1-like protein {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  18  26.RLYSCLDHMREPDDILTEAILKHKFDVQKALSVVLEQ........................... 68
7 -5.400d3cu7a8 b.1.29.1 (A:1370-1513) Complement C5 MG8 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  50............SSHAVMDISLPTGISANEEDLKALVEGVDQLFTDYQIKDGHVILQL....... 95
8 -5.240d1vzma_ g.32.1.0 (A:) automated matches {Argyrosomus regius [TaxId: 172269]}  ali model 3D-neighbors follow..  15  24.........................MADAQGIVAAYQAFYGPIP..................... 42
9 -5.200d2nyua_ c.66.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  128..LSVTPDILQPGGTFLCKTWAGSQSRRQRRLTEEFQNVRIIKPEASRKESS............. 178
10 -5.040d2q4pa_ a.204.1.2 (A:) XTP3-transactivated gene A protein homolog RS21-C6 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  10  66KERAALQEELSDVLIYLVALAARCHVDLPQAVISKMDTNRQRYPVH................... 111

FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.