current user: public

If you have questions about the server, please let us know.

Query: d1dj7b_ b.34.4.3 (B:) Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain {Synechocystis sp. [TaxId: 1143]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
# Score Template Links and tools%idFirst MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLILast
1 -61.500d1dj7b_ b.34.4.3 (B:) Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain {Synechocystis sp. [TaxId: 1143]}  ali model 3D-neighbors  100  1MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLI 73
2 -9.050d3hhtb_ b.34.4.4 (B:) automated matches {Geobacillus pallidus [TaxId: 33936]}  ali model 3D-neighbors follow..  15  142FKVGERIKTKNIHPTGHT---RFPRY-ARDKYGVIDEVYGAHHRKGENPQYLYRVRFEAE............. 204
3 -6.780d2heqa1 b.34.20.1 (A:7-71) Uncharacterized protein YorP {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  27  6YPVGLAVEINNNAR-YGCPHH--------GRKGKIIEHLH-------SATYDYAVSDETGDITYFKEHELTPL 63
4 -5.950d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  19  69...GVRYPMAGIGYVASYPEYRGEGGISAIMKEMLADLAK--QKVALSYLAPFSYPFYRQY............ 124
5 -5.930d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  14  77...GALYKMGGVTGVGTYPEYANHGLMKDLIQTALEEMRQ--DKQWISYLFPYNIPYYRRK............ 132
6 -5.780d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]}  ali model 3D-neighbors follow..  19  66...GQRVPMAGIAAVGIAPEYRGDGAAIALIQHTLQEISE--QDIPISVLYPATQRLYRKA............ 121
7 -5.340d5aooc_ b.121.4.0 (C:) automated matches {Aichivirus a [TaxId: 72149]}  ali model 3D-neighbors follow..  11  104LLFTGSAQHYGRLVVCYTPAAPQPPSTMQEAMRGTYTVWDVNAASTLEFTIPFI................... 157
8 -5.170d1qqp3_ b.121.4.1 (3:) Aphthovirus (Foot-and-mouth disease virus) coat proteins {FMDV (Foot-and-mouth disease virus), strain bfs, 1860 [TaxId: 12110]}  ali model 3D-neighbors follow..  109FMFTGPTDAKARYMVAYAPPGMEPPKTPEAAAHCIHAEWDTGLNSKFTFSIPY.................... 161
9 -4.980d1je5a_ b.40.4.7 (A:) gp2.5 {Bacteriophage T7 [TaxId: 10760]}  ali model 3D-neighbors follow..  20  143IGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWAD....................... 192
10 -4.930d1tme3_ b.121.4.1 (3:) Theilovirus capsid proteins {Theiler`s murine encephalomyelitis virus, strain da [TaxId: 12124]}  ali model 3D-neighbors follow..  113FVFTGAAMVKGKFLIAYTPPGAGKPTTRDQAMQATYAIWDLGLNSSFVFTAPF.................... 165

FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 6 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.