current user: public

If you have questions about the server, please let us know.

Query: d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGLast
1 -41.500d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]}  ali model 3D-neighbors  100  1SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAG 144
2 -11.900d1eq1a_ a.63.1.1 (A:) Apolipophorin-III {Tobacco hornworm (Manduca sexta) [TaxId: 7130]}  ali model 3D-neighbors follow..  5GGNAFEEMEKHAKEFQKTFSEQFNSLVNSKNTQDFNKALKDGSDSVLQQLSAFSSSLQGAISDANGKAKEALEQARQNVEKTAEE-LRKAHPDVEKEANAFKDKLQAAVQTTVQESQKLAKEVASNMEETNKKLAPKIKQAYD. 146
3 -7.680d3f31a_ a.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  1TAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKH-QAFEAEVQANSGAIV-KLDETGNLMISEGHFASETIRTRLHRQWELLLEKMREKGIKLLQ........ 137
4 -7.300d3fava_ a.25.3.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  13  2.....................................................................AQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQAGVQYS.. 74
5 -7.260d1i5pa3 f.1.3.1 (A:1-263) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis subsp. kurstaki, CRY2AA [TaxId: 29339]}  ali model 3D-neighbors follow..  11  87............TNLMQDILRETEQFLNQRLNTDTLARVNAELIGLQANIREFNQQVDNFLNPTQNPVPLSITSSVNTMQQLFLNRLPQFQIQLFAQAANMHATLRTYRDYLRNYTRDYSNYCINTYQTAFRGLNTRLHDMLE. 243
6 -6.690d1t98a2 a.47.6.1 (A:119-281) Chromosome partition protein MukF (KicB), C-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  3STLRLSMQLSIVAGELKRAADAAEEGGDE---FHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHVDRLVFDLQSKLD..... 143
7 -6.420d1sg2a_ f.48.1.1 (A:) Periplasmic chaperon skp (HlpA) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  20...........................................TGVSNTLENEFKGRASELQRMETDLQAKMKKLQSMKAGSDR---TKLEKDVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANS....... 110
8 -6.080d1aepa_ a.63.1.1 (A:) Apolipophorin-III {Migratory locust (Locusta migratoria) [TaxId: 7004]}  ali model 3D-neighbors follow..  16  1.....................................NIAEAVQQLNHTIVNAAHELHETLGPTPDEALNLLTEQANAFKTKIAEVTTSLKQEAEKHQGSVAEQLNAFARNLNNSIHDAATSLN--LQDQLNSLQSALT..... 101
9 -6.000d2b0ha1 a.24.9.2 (A:1843-1973) Talin 1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  4PEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSP--EELGPLANQLTSDYGRLASQAKPAAVAAENEIGAHIKHRVQELGHGCSALVTKAGA--SPSDVYTKKELIECARRVSEKVSHVLAALQA................... 128
10 -5.990d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  216.....................................................AQASAKMLHEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKM...... 300

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.