current user: public

If you have questions about the server, please let us know.

Query: d1j6oa1 c.1.9.12 (A:0-255) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MVDTHAHLHFHQFDDDRNAVISSFEENNIEFVVNVGVNLEDSKKSLDLSKTSDRIFCSVGVHPHDAKEVPEDFIEHLEKFAKDEKVVAIGETGLDFFRNISPAEVQKRVFVEQIELAGKLNLPLVVHIRDAYSEAYEILRTESLPEKRGVIHAFSSDYEWAKKFIDLGFLLGIGGPVTYPKNEALREVVKRVGLEYIVLETDCPFLPPQPFRGKRNEPKYLKYVVETISQVLGVPEAKVDEATTENARRIFLEVKELast
1 -117.000d1j6oa1 c.1.9.12 (A:0-255) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors  100  1MVDTHAHLHFHQFDDDRNAVISSFEENNIEFVVNVGVNLEDSKKSLDLSKTSDRIFCSVGVHPHDAKEVPEDFIEHLEKFAKDEKVVAIGETGLDFFRNISPAEVQKRVFVEQIELAGKLNLPLVVHIRDAYSEAYEILRTESLPEKRGVIHAFSSDYEWAKKFIDLGFLLGIGGPVTYPKNEALREVVKRVGLEYIVLETDCPFLPPQPFRGKRNEPKYLKYVVETISQVLGVPEAKVDEATTENARRIFLEVKE 256
2 -113.000d2gzxa_ c.1.9.0 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}  ali model 3D-neighbors follow..  39  1LIDTHVHLNDEQYDDDLSEVITRAREAGVDRMFVVGFNKSTIERAMKLIDEYDFLYGIIGWHPVDAIDFTEEHLEWIESLAQHPKVIGIGEMGLDYHWDKSPADVQKEVFRKQIALAKRLKLPIIIHNREATQDCIDILLEEHAEEVGGIMHSFSGSPEIADIVTNLNFYISLGGPVTFKNAKQPKEVAKHVSMERLLVETDAPYLSPHPYRGKRNEPARVTLVAEQIAELKGLSYEEVCEQTTKNAEKLFN.... 253
3 -110.000d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  33  3LVDSHCHLDGLDYEKDVDDVLAKAAARDVKFCLAVATTLPSYLHMRDLVGERDNVVFSCGVHPLNQND--PYDVEDLRRLAAEEGVVALGETGLDYYYTPETKVRQQESFIHHIQIGRELNKPVIVHTRDARADTLAILREEKVTDCGGVLHCFTEDRETAGKLLDLGFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDSPYLAPVPHRGKENQPAMVRDVAEYMAVLKGVAVEELAQVTTDNFARLFHIDAS 259
4 -108.000d3rcma1 c.1.9.0 (A:1-268) automated matches {Pseudomonas putida [TaxId: 160488]}  ali model 3D-neighbors follow..  30  3LIDIGVNLTNSSFHDQQAAIVERALEAGVTQMLLTGTSLAVSEQALELCQQLDHLFATAGVHPHDAKAWDTDSERQLRLLLSEPRVRAVGECGLDFNRDFSPRPLQEKALEAQLTLAAQLRLPVFLHERDASERLLAILKDYRDHLTGAVVHCFTGEREALFAYLDLDLHIGITGWICDRRGTHLHPLVGNIPEGRLMLESDAPYLLPRSLRPKRNEPAFLPEVLREVALHRGESAEHTAAHTTATARDFFQLPAE 267
5 -106.000d1zzma1 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  27  5FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAENFARVLALAENYQPLYAALGLHPGMLEKHSDVSLEQLQQALERAKVVAVGEIGLDLFGDDPQFERQQWLLDEQLKLAKRYDLPVILHSRRTHDKLAMHLKRHDL-PRTGVVHGFSGSLQQAERFVQLGYKIGVGGTITYPRASKTRDVIAKLPLASLLLETDAPDMPLNGFQGQPNRPEQAARVFAVLCELRREPADEIAQALLNNTYTLFNVP.. 259
6 -98.000d2y1ha1 c.1.9.0 (A:5-272) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  4LVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGVLPCLGVHPVQGLPPEDQRSVTLKDLNYKDRLLAIGEVGLDFSPRFAQKEEQRQVLIRQIQLAKRLNLPVNVHSRSAGRPTINLLQEQGA--EKVLLHAFDGRPSVAMEGVRAGYFFSIPPSIIRSGQ--KQKLVKQLPLTSICLETDSPALGP--EKQVRNEPWNISISAEYIAQVKGISVEEVIEVTTQNALKLFPKLRH 266
7 -82.100d3gg7a1 c.1.9.0 (A:2-242) automated matches {Deinococcus radiodurans [TaxId: 1299]}  ali model 3D-neighbors follow..  22  1.IDFHVHLDLY----PDPVAVARACEERQLTVLSVTTTPAAWRGTLALAAGRPHVWTALGFHPEVVSERAAD-LPWFDRYL--PETRFVGEVGLDGSPSLRGWTQQFAVFQHILRRCEDHGGILSIHSRRAESEVLNCLEANPRSG-TPILHWYSGSVTELRRAISLGCWFSVGP--TMVRTQKGAALIRSMPRDRVLTETDGPFL---ELDGQAALPWDVKSVVEGLSKIWQIPASEVERIVKENVSRLLGT... 241
8 -27.500d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  7YTLAHEHLDLSGFKNNVDQEMNDLMTRGVRNVIEMTN--RNAQFMLDVMRETGNVVACTGYYQDAFEHVATRSVQELAQEMVDEIEQGIGIIAEIGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSFSTMEQLALLQAHGVDLSRVTVCDLKDNLDNILKMIDLGAYVQFDTIGKEKRIAMLHALRDRGLLNRVMLSMDITRRSHLKANGGYGYDYLLTTFIPQLRQ-SGFSQADVDVMLRENPSQFFQ.... 291
9 -21.900d2icsa2 c.1.9.14 (A:55-321) Putative adenine deaminase EF0837 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  14  2WIDDHVHCFEKMALYYDYP--EIGVKKGVTTVIDAGTNIHEFYDLAQQAKTNVFGLVNISVAQDELADLSKVQASLVKKAIQELPDFVVG-IKARMSRTVIGDNGITPLELAKQIQQENQEIPLMVHIGSAPPHLDEILALMEKGDV--LTHCFNGKKDFAWQAYNKGVVFDIGHGTDSFNFHVAETALRE-GMKAASISTDI-----YIRNRENGPVYDLATTMEKLRVV-GYDWPEIIEKVTKAPAENFHLTQK 266
10 -19.300d5vn5a_ c.1.9.0 (A:) automated matches {Sphingobium sp. [TaxId: 627192]}  ali model 3D-neighbors follow..  16  2IIDCHGHVSAPVELWWPDGHIELLHNHGTDMQLVHWFCEEVNTLIHRQCTLIPEMFIPVAGLPQVAGEPIENVFAEMD------RCVSMGFKGFLLNPDEEAPPLGDRYWYPLYEKLCELDLPAHIHATGSQSERSPYSLHFINEETIATYNLCTSSV--FDDFPQLKVVVSHGGDTVLYTEGALRLLIETVGPERCLFGSECPGVGSTIDPATGKQ---MDHIAPFIQKFDFLSDADKKLIFEDNARKVFNL... 330
11 -18.100d2gwga1 c.1.9.15 (A:1-342) 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas palustris [TaxId: 1076]}  ali model 3D-neighbors follow..  13  2IIDIHGHYTTAPKALIIENQLKKMQERGSDLTVSSTWAAICNELCYRVSQLFPDNFIGAAMLPQSPGVDPKTCIPELEKCVKE-----YGFVAINLNPDPSSPPLTDRIWYPIYEKMVELEIPAMIHVSTSCNTCFTTGAHYLNADTTAFMQCVAGDL--FKDFPELKFVIPHGG-TCVYHQPGIDLLNTVIPVDNVLFASEMIG---AVRGIDPRTGFYYDDTKRYIEASTILTPEEKQQIYEGNARRVYPRLDA 335
12 -18.100d1po9a2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  2FIDQHVHLEAGPTTRTPEVALSRLTEAGVTSVVGLTDSISRHPESLLAKTRALNEEGISAWMLTGAYHVPSRTITGSVEKDVAIIDRVIGKCAISDHRSAAPDVYHLANMAAESRVGGLLPGVTVFHMGDSKKALQPIYDLLENCDV--PISKLLPTFEQALEFARKGGTIDITSSIDAPAEGIARAVQAGIPLARVTLSSDGNGSQPFFDDEGNAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGK 283
13 -17.700d3ij6a1 c.1.9.0 (A:3-304) automated matches {Lactobacillus acidophilus [TaxId: 1579]}  ali model 3D-neighbors follow..  16  3.IDAYAHILPAKYYQDLDERLTKWPDQNTKQVISLANDFTDSKTSAELCQSNEELSNLVDQHPGKFAGAIESACKVISSIKDD-----ENLVGAQIFTRHLGKSIADKEFRPVLAQAAKLHVPLWMHVFDARKPDNNLVFSWEYELSQAMLQLVQSDL--FQDYPNLKILVHHAGTAILGNTPALQLAIDYYGIDHVLFGTDAPF---------AVMPSGADQIITQAINDLTISDKDKQKIFHDNYYSLIK.... 301
14 -16.900d2f6ka1 c.1.9.15 (A:2-307) Putative amidohydrolase LP2961 {Lactobacillus plantarum [TaxId: 1590]}  ali model 3D-neighbors follow..  11  3.IDFHTHYLPTSYVETPQLTLNFMRDNDISYSISPHVNFGDKAETIRLVEANDDGKSLAQQYPDQLGYLASLPIPYELDAVKTVQLDQDGALGVTVPTNSRGLYFGSPVLERVYQELDARQAIVALHPKNVDIDLPVPLLGFFMDTTMTFINMLKYHF--FEKYPNIKVIIPHAGVAGAVLPRQLPTLMSLAQPEHLLYGSDIPY----------TPLDGSRQLGHALATTDLLTNEQKQAIFYDNAHRLLT.... 305
15 -16.400d2wm1a_ c.1.9.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  3.IDIHSHILPKEWPDDPEVRIREMDQKGVTVQATLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERC--------VKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDWLPWLVGMPAETTIAICSMIMGGV--FEKFPKLKVCFAHGG-ALVHDPLSLKLLTDVIGKDKVILGTDYPF------------PLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLER. 332
16 -16.200d3a4ja_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  15  21...THEHICGSALAEKAVRGLRHARAAGVQTIVDIGRDVRLLAEVSRAAD---HIVAATGLWFDPPLSMRMRSVEELTQFFLREIQHGIEDTGIKVATTGKATPFQELVLRAAARASLATGVPVTTHTQRGGEQQAAIFESEGLSPSRVCIHS-TDDLSYLTGLAARGYLVGLDRM-WQTRALLIKALIDRGYKDRILVSHDWLFGFSSYVTNIMDV-AFVPLRVIPFLREKGVPPETLAGVTVANPARFLS.... 326
17 -16.100d2hbva1 c.1.9.15 (A:3-333) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  15  3RIDMHSHFFPRISEQDPAFRIEEMDAQGVDVQVTCATPTWEANKAAQWAERMDFALEFAAHNPQRIKVLAQVPLQDLDLACKESRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGLPWLVAMPAETQLAILSLILSGAFERIPKSLKI-CFGHGGGSFAF-NPGALELLVSVMGEDRVMLGSDYPFPLGEQ--------------IGGLVLSSNLGESAKDKIISGNASKFFNI... 330
18 -15.300d2ffia1 c.1.9.15 (A:10-280) Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 {Pseudomonas putida [TaxId: 303]}  ali model 3D-neighbors follow..  11  5AIDSHAHVFSRGLDAPLGDYLGQLRAHGFSHGVLVQPSFTDNRYLLSALQTVPGQLRGVVMLERDVEQATLAEMAR-------------GVRGVRLLMGQDMPDLTGAQWRPLLERIGEQGWHVELHRQADIPVLVRALQPYGLDIV--IDHF-PGFAELLTLSGRGKVWVKVSGIYRLQGSPELCALEAHYGAERLMWGSDWPHTQ---HESEVSFGSAVEQFEALGC-----SAQLRQALLLDTARALFGF... 270
19 -14.600d3pnza_ c.1.9.0 (A:) automated matches {Listeria monocytogenes [TaxId: 267410]}  ali model 3D-neighbors follow..  15  20...SHEHIVCVDDKEKSQLDVQDFADLGGKTIVDYGRRVLDVAQISKETG---QIVGTAGFNETYYEWIENTTTDKLTEFVVNEVENGLEGTPY----YNMITPLEEKTIRAVARAHHETKAPIHSHTEAGTMEQIEILKQENIPLEYLSIHM-NLDPYYHKQVAKTGAFMSFDGI---ARIAAILYLVSEGFEDQILVSGDTARKTYYKHYGHGPGLEYIPRFIDEANEKGFDGEKLVKKFFVDNPARCFTFKK. 329
20 -14.500d4i6ka_ c.1.9.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 480119]}  ali model 3D-neighbors follow..  11  3CIDTHAHVYAPDYEATVQSFISHLDEHNFTHGVLVQPSFTNNQAMLNAIQQYPDRLKGIAVVQHTTTF------NELVNLKAQ------GIVGVRLLFGLNLPALNTPDWQKFLRNVESLNWQVELHAPKYLVQLLPQLNEYSFDVV--IDHF-PDYQKFLSLLNVKQHWIKVSGFYRLGATPSYNIFKEKGFLHKLIWGSDWPHTQ---HESLITYEDAIKAFKQIVF-----DKHEQCLILNQNPTELFG.... 266
21 -14.400d3tn4a_ c.1.9.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}  ali model 3D-neighbors follow..  16  20...IHEHFLFGESLRVAVEAAEKMKRHGIQTVVDCGRNPAFLRRVAEETG---NIICATGYYYEGERRLLGTAEDDIYDMFMAELTEGIADTGI----KGRITEYEKMFFRAAARAQKETGAVIITHTQEGTMEQAAYLLEHGADPKKIVIHM-NTDPDYHRKTLAYGVYIAFDRF---ERVRTLLALLRDGYEKQIMLSHDTPFTLPEPFAEMMKNWHVEHLFVNIIPALKGIRDEVLEQMFIGNPAALFS.... 323
22 -14.400d4rdza1 c.1.9.0 (A:1-314) automated matches {Vulcanisaeta moutnovskia [TaxId: 985053]}  ali model 3D-neighbors follow..  15  22...FHEHLNEDEELKRAIDAVNAAKKYGVKTIIDIGCDVRFNEKVAKATG---NIIMGTGFYTEIPFYFKNRGIDSLVDAFVHDITIGIQGTNT----SSGLTKDVEMAIRAAAKAHIKTDVPIITHSFVGNKDLIRIFKEEGVDLARTVIHV-TDDISFIEQILREGAFIGLDRF-LDKRVKTAIELIKRGWIDQLLLSHDIDWYPPEVVRSTVPDWTMTLIFEKVIPRMRGITEEQINRVLIDNPRRLFT.... 313
23 -13.500d1gkra2 c.1.9.6 (A:55-379) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]}  ali model 3D-neighbors follow..  12  2VVDEHVHIIDMDLKNRYGRFSESAAVGGITTIIEMPITFPPTTTLDAFLEKKKQAGQRLKVDFALYGGGVPGNLPEIRKMHDA------GAVGFKSMMAASVPGVSDGELFEIFQEIAACGSVIVVHAENETIIQALQKQIKAAGGKDMAAYEASQENEAIQRALLLQKEAGCRLIVLHVSNPDGVELIHQAQSEDVHCESGPQYLAP-PVRSAEMNIRLWEQLENGLIDTGRLSLERLVEVMCEKPAKLFGIYPQ 323
24 -13.300d2z26a_ c.1.9.4 (A:) Dihydroorotase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  10PDDWHLHLR----DGDMLKTVVPYTSEIYGRAIVMPNLAPPVTTVEAAVAYRQRILDAVPAG--TCYLTDSLDPNELERGFNEGVFTAAKLYPANATANSSHGVTSVDAIMPVLERMEKIGMPLLVHGEVTTKDAADYVRDGNERLAATITHLMFNRNHMLVGGVRPHLYCL---LKRNIHQQALRELVASGFNRVFLGTDSAPHARHRKESGCFNAPTALGSYATVFEE--MNALQHFEAFCSVNGPQFYGLPVN 306
25 -13.200d4qrna1 c.1.9.0 (A:1-351) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  11  15RIATEEAFATREIIDLGERRIADMDATGIDKAILALTSLHDLDEARTLATRNDTLADACQKYPDRFIGMGTVAPQDPEWSAREIHARELGFKGIQINSHTQGRYLDEEFFDPIFRALVEVDQPLYIHPAETGMHLLRLI-------TIGIFDKYPS-KKTIEGYLKSNVLVTNSGVAW---EPAIKFCQQVMGEDRVMYAMDYPY-------------QYVADEVRAMDAM-DMSAQTKKKFFQTNAEKWFKL... 351
26 -13.100d2imra2 c.1.9.16 (A:91-398) Hypothetical protein DR0824 {Deinococcus radiodurans [TaxId: 1299]}  ali model 3D-neighbors follow..  14  3PVNAHTHLDMSAYEFQALPYADTLTRLGAGGVGDIVWAPEVMDALLAREDLSGTLYEVLNPFPDKADEVFAAARTHLERWRRLER-----RLGLSPH---TPFTVSHRLMRLLSDYAAGEGLPLQIHVAEHPTELEMFRTGGGPAARPTLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLECGTFDWPAFAAAGEVALGTDS--------VASGETLNVREEVTFARQLYPGLDPRVLVRAAVKGGQRVVGGRT. 307
27 -13.100d2dvta1 c.1.9.15 (A:1-325) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]}  ali model 3D-neighbors follow..  13  4KVALEEHFAIPETLQIQDTRLKLMDAHGIETMILSLNAIPDRRKAIEIARRNDVLAEECAKRPDRFLAFAALPLQDPDAATEELQ--CVNDLGFV---GQTPLYYDLPQYRPFWGEVEKLDVPFYLHPRETAVHALRLM-------ASGLFDEHPRAKRRFMDYFNENFHITTSGNFR---TQTLIDAILEIGADRILFSTDWPFENIDH--------------ASDWFNATSIAEADRVKIGRTNARRLFKL... 324
28 -12.900d1gkpa2 c.1.9.6 (A:55-389) D-hydantoinase {Thermus sp. [TaxId: 275]}  ali model 3D-neighbors follow..  13  1FIDPHVHIYLPFMADTHETGSKAALMGGTTTYIEMCCPSRNDDALEGYQLWKSNSYCDYTFH--AVSKFDEKTEGQLREIVADQKLLSEGKTGPEWHEPSRPEAVEAEGTARFATFLETTGATGVVHL--SCKPALDAAMAAKARGVPIYIESVIPHFLLDKTYAERGGVEAMKYIMSLRDKRNQKVLWDALAQGFITVGTDCPFDTEQKLLGKEA-EDRVNLLYTYGVSRGRLDIHRFVDAASTKAAKLFGLFPR 326
29 -12.400d1nfga2 c.1.9.6 (A:52-381) D-hydantoinase {Burkholderia pickettii [TaxId: 329]}  ali model 3D-neighbors follow..  14  2GIDVHTHVETVSFNDTFATATVAAACGGTTTIVDFCQQDRGHSLAEAVAKWDGMAGGKSAIDYGYHIIVLDPTDSVIEEL---EVLPDLGITSFKVFMAYRGMMIDDVTLLKTLDKAVKTGSLVMVHAENGDAADYLRDKFVAEGKTAPIYHALSVEAEATARALALAEIVNAPIYIVHVTCEESLEEVMRAKSRRALAETCTHYLTP-PARAKKDHDVLWNALRNGVFETGRISLTQFVELVATRPAKVFGMFPQ 327
30 -12.000d2ftwa2 c.1.9.6 (A:60-393) Dihydropyrimidine amidohydrolase Pyd2 {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}  ali model 3D-neighbors follow..  15  3GIDTHTHFQLPVSVDDFDIGTQAAVAGGTTFIIDFVIPTRGQSLLEAYDQWKKKVNCDYSLH--AITWWSEQVSREMEILVKERGVNSFGITGPEGHELSRPEALEAEATNRAIVIADSVCTPVIVHV--QSIGAADVICKHRKEGVRVYGEPIAAGLGVDGSHMWNHDWRHAAAFVM-PDPRTKGVLMDYLARGDLCVGTDCTFCADQKAMGKDD-EDRMSIVWENGVNTGKLTWCQFVRATSSERARIFNIYPR 331
31 -12.000d2fvka2 c.1.9.6 (A:57-440) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]}  ali model 3D-neighbors follow..  14  2GIDAHVHVDEPDVVDTMEHATRSAVAGGTTTVVAFSTQDVSKKGPSALAESVQTLYCDYGLHLILFQIEKPSVEAELLDVQLQAAYNDYGVSSVKMFMTYPGLQISDYDIMSAMYATRKNGFTTMLHAENGDMVKWMIEALEEQGLTDAYYHGVSVEGEATNRAITLATTMDTPILFVHVSSPQAAEVIKQAQTKKVYAETCPQYASP-PIRPEGTQKSIWKGMNNGTFTINLTSMMKLVEIQCTNPAKVYGMYPQ 381
32 -11.800d2puza2 c.1.9.17 (A:80-380) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  15  3LIDCHTHLVFRDTRALSDEVLVAQALPRLDTLLSEGVDIETELKMLRVARRLETVTSYLAAH-GRNADYITDVVLPGLEKAHAEGLADAVDG-------CEGIAFSVKEIDRVFAAAQQRGLPVKLHAEQLSNL--GGAELAASYNALSADHLEYLDETGAKALAKAGTVAVLLPGAFYALREKQLPPVQAL---EIALATDC--------NPGTSPLTSLLLTMNMGATLFRMTVEECLTATTRNAAKALGLLAE 298
33 -11.800d3pnua1 c.1.9.0 (A:1-335) automated matches {Campylobacter jejuni [TaxId: 192222]}  ali model 3D-neighbors follow..  14  6PLDMHLHLR----DNQMLELIAPLSARDFCAAVNLIPPLCNLEDLKAYKMRILKACKDENFTPLMTLFFKNYDEKFLYSAKDEIFGIKLYPAGITTNSNGGVSSFDIEYLKPTLEAMSDLNIPLLVHGETTTKTLCELLKDYENLYATITLHHLIITLDDVIGGKMNPHLFCKPIAKRYEDKEALCELAFSGYEKVMFGSDSAPHPKDTKE-GVFSAPVILPVLAELFKQ--NSSEENLQKFLSDNTCKIYDLKFK 295
34 -10.300d1p1ma2 c.1.9.9 (A:50-330) Hypothetical protein TM0936, probable catalytic domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  13  2LFNTHTHAPMTLLRGVAEDLQMEMARHGIAGFVDMYFHEEWIAKAVRDFGMRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVG------FGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSKEELEDILNIGLKEVKTIAHCVHLPERYFGVLKDIPFFVSHNPASNLKLGNGIAPVQRMIEHGKVTLGTDGA--------ASNNFEMRLASLLQKAQNPRNLDVNTCLKMVTYDGAQAMGF... 278
35 -9.930d1xrta2 c.1.9.6 (A:56-365) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  15  2FIDIHVHLRDPTYKEDIESGSRCAVAGGFTTIVCMPNTNPDNTTVVNYILQKSKSVGLCRVLPTGTITKGRKGKE--------ADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGVPIMDHCEDDKLAYGVINEGEVSALLGLSSRAPEAEEIQIARDGILAQRTGGHVHIQHVSTKLSLEIIEFFKEKGVKITCENPNVNP-PLRKKEDRLALIEGVKRGIIDCGIISLKKLIEMFTINPARIIGVDL. 309
36 -9.820d1ra0a2 c.1.9.5 (A:56-375) Cytosine deaminase catalytic domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  2FVEPHIHLDTDDVKQRAWQTLKWQIANGIQHVRTVDVSDATLTALKAMLEVKQEVAPWIDLQIVAFPQEGILSYPNGEALLEEALRLGADVVG----HFEFTREYGVESLHKTFALAQKYDRLIDVHCDEIDDEQSRFVETVAALAHH-ASHTTA-NGAYTSRLFRLLKMSGINFVANPLVNIHLQGRFDTYPKRRVCFGHDGVFDPWYPL-GTANMLQVLHMGLHVCQLMGYGQINDGLNLITHHSARTLNLQD. 310
37 -9.630d1o12a2 c.1.9.10 (A:44-331) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  14  2FVDPHIH-GADTMNCDFSEMEEFLYSQGVTTFLTVSTSLEKMKEILRKARDYIL--SLLGVHAHSEKHIRPPSERELSEIDSPAKMLTFAP-------EIESSELLLRLVKRDIVLS-------AGHSIATFEEFMKFYKE----GVKRITHFPNGLKPLHHRLLLDDVKLELICDGVHLSREMVKLVYKVKKANGIVLVTDSISAAGLK----AGSTLFFSQAVKNFRKFTGCSITELAKVSSYNSCVELGLDDR 287

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.