current user: public

If you have questions about the server, please let us know.

Query: d1jb7a2 b.40.4.3 (A:205-328) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst VISSDMYTALNKAQAQKGDFDVVAKILQVHELDEYTNELKLKDASGQVFYTLSLKLKFPHVRTGEVVRIRSATYDETSTQKKVLILSHYSNIITFIQSSKLAKELRAKIQDDHSVEVASLKKNVLast
1 -84.700d1jb7a2 b.40.4.3 (A:205-328) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}  ali model 3D-neighbors  100  1VISSDMYTALNKAQAQKGDFDVVAKILQVHELDEYTNELKLKDASGQVFYTLSLKLKFPHVRTGEVVRIRSATYDETSTQKKVLILSHYSNIITFIQSSKLAKELRAKIQDDHSVEVASLKKNV 124
2 -11.600d1iyjb5 b.40.4.3 (B:2980-3117) OB-fold domains of BRCA2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  10  15.............QPPCSEVDVVGVVVSVVKPIGLAPLVYLSDECLHLLVVKFGIDLNEDIKPRVLIAASNLQWRPESTSRVPTLFAGNFSVFSASPKEAHFQERVTNMKH............. 112
3 -11.500d1o7ia_ b.40.4.3 (A:) Archaeal ssDNA-binding protein {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  17  1.....MEEKVGNLKPNMESVNVTVRVLEASEARQIQTEAIVGDETGRV-KLTLWGKHAGSIKEGQVVKIENAWTTA--KGQVQLNAGSKTKI................................ 93
4 -11.000d1wjja1 b.40.4.3 (A:8-139) Hypothetical protein At4g28440 (F20O9.120) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  12  6...KPVFVKVEQLKPGTTGHTLTVKVIEANIVVPVTRECLIGDETGCI-LFTARNDQVDLMKPGATVILRNSRIDM--KGTMRLGVDKWGRI................................ 110
5 -10.500d1xjva2 b.40.4.3 (A:149-299) Protection of telomeres protein 1, Pot1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  2......LLKLCDVQPMQ--FDLTCQLLGKAEVDGASFLLKVWDGT-DILVYDNHVHVARSLKVGSFLRIYSLHTKLQSMNSENQTMLSLEFHLH--GGTSYGRGIRVLPESNSDVDQLKKDLE. 145
6 -9.910d1xjva1 b.40.4.3 (A:6-145) Protection of telomeres protein 1, Pot1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  6......YTPLNQLKGGT--VNVYGVVKFFKP-TDYCSVVTIVDQTNVKLTCLLFSGNYEALKNGDIVRFHRLKIQVYKKETQGITSSGFASLT............................... 100
7 -8.710d1jb7a1 b.40.4.3 (A:36-204) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}  ali model 3D-neighbors follow..  19  3......YVELAKASLTSAQQHFYAVVIDATF-ERYICSLKIVDPT-TLVLYAKRFEDLPIIHRGDIIRVHRATLRLYNGQRQFNANVFYSSSWAL............................. 113
8 -8.420d1qzga_ b.40.4.3 (A:) Protection of telomeres protein 1, Pot1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}  ali model 3D-neighbors follow..  24....QSIRSSQELQKKNTIVNLFGIVKDFTP-KDWVTTVYLWDPT-QIHLFSKQGNDLPVIKQGQPLLLHQITLRSYRDRTQGLSKDQFRYAL............................... 127
9 -7.680d1jmca1 b.40.4.3 (A:183-298) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  2......VVPIASLTPYQSKWTICARVTNKSQIRTWSNSLELVDESGEI-FNEQVDKFFPLIEVNKVYYFSKGTLKIANKQDYEMTFNNETSVMPCEDDHHLPT..................... 115
10 -6.540d3rloa2 b.40.16.1 (A:673-766) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  33......................................YEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHI................................ 86

FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 6 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.