|
current user: public |
|
Query: d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]}, from SCOP207 |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 | |||||||
# | Score | Template | Links and tools | %id | First | AKTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN | Last |
1 | -76.900 | d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]} | ali model 3D-neighbors | 100 | 1 | AKTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN | 92 |
2 | -67.400 | d3ui4a1 d.26.1.1 (A:36-131) automated matches {Human (Homo sapiens) [TaxId: 9606]} | ali model 3D-neighbors follow.. | 34 | 1 | .NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKA-RQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVKTKFGYHIIMVEGRK | 96 |
3 | -63.900 | d2kgja1 d.26.1.0 (A:1-94) automated matches {Escherichia coli [TaxId: 83333]} | ali model 3D-neighbors follow.. | 21 | 4 | .QRTRYSIIQTKTEDEAKAVLDELNKGGDFAALAKEKSADISARNGGDMGWLEDATIPDELKNAGL-KEKGQLSGVIKSSVGFLIVRLDDIQ | 94 |
4 | -62.100 | d2mnta_ d.26.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]} | ali model 3D-neighbors follow.. | 29 | 32 | .TRSRADAINLAQAILAQHKERKTWSLDEFVQVVRDFSECGSAKRDGDLGMVESGTYTEGFDTVAFSLKSGEVSAPVETELGVHLIYRVE.. | 120 |
5 | -60.200 | d2pv1a_ d.26.1.1 (A:) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} | ali model 3D-neighbors follow.. | 32 | 2 | ..ELNLSHILIEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLR | 103 |
6 | -59.400 | d2itka2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} | ali model 3D-neighbors follow.. | 37 | 3 | .ARVRCSHLLVEALELINGYIQKIKSGEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE.. | 113 |
7 | -58.100 | d2jzva1 d.26.1.0 (A:140-245) automated matches {Staphylococcus aureus [TaxId: 1280]} | ali model 3D-neighbors follow.. | 33 | 1 | .DSKKASHILIEAKQKAEEIQKEVKDPSKFGEIAKKESMDTSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADK.. | 106 |
8 | -53.800 | d4g2pa1 d.26.1.0 (A:280-386) automated matches {Salmonella enterica [TaxId: 588858]} | ali model 3D-neighbors follow.. | 30 | 4 | .TEVHARHILLQARLKLEEIAADIKSGTTFAAAAKEYSQDPSANQGGDLGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTR | 105 |
9 | -6.250 | d1e19a_ c.73.1.1 (A:) Carbamate kinase {Pyrococcus furiosus [TaxId: 2261]} | ali model 3D-neighbors follow.. | 11 | 222 | AEEVNADIFMILTDVNGAALYYGTEKEQWLREVKVEELRKYYEE-----GHFKAGSMGPKVLAAIRFIEWGKAVEALEGKTGTQVL...... | 312 |
10 | -5.620 | d2qlua1 d.144.1.0 (A:190-484) automated matches {Human (Homo sapiens) [TaxId: 9606]} | ali model 3D-neighbors follow.. | 18 | 131 | .RDFKSKNVLLKSDLTAV---------ADFGLAVRFEPGKPPGDTHGQVG--TRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRC | 211 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02. |