current user: public
If you have questions about the server, please let us know.

Query: d1kjqa1 b.84.2.1 (A:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli [TaxId: 562]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
# Score Template Links and tools%idFirst GPAASAVILPQLTSQNVTFDNVQNAVGADLQIRLFGKPEIDGSRRLGVALATAESVVDAIERAKHAAGQVKVQGLast
1 -51.400d1kjqa1 b.84.2.1 (A:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors  100  1GPAASAVILPQLTSQNVTFDNVQNAVGADLQIRLFGKPEIDGSRRLGVALATAESVVDAIERAKHAAGQVKVQG 74
2 -35.200d3etja1 b.84.2.1 (A:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  9  2NPSVMINLIGSDVNYDW-------LKLPLVHLHWYDK-EVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEY 67
3 -7.860d1lk9a_ c.67.1.1 (A:) Alliinase {Garlic (Allium sativum) [TaxId: 4682]}  ali model 3D-neighbors follow..  14  207NPEGLLRSIYDMVYYWPHYTPIKYKADEDILLFTMSKFTGHSGSRFGWALIKDESVYNNLLNYMTKNTE..... 283
4 -7.490d1vkza1 b.84.2.1 (A:314-399) Glycinamide ribonucleotide synthetase (GAR-syn), C-domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  21  1GFAVDVVLAARGYPDAPEKGKEITLPEEGLIFF--GKLVTNGGRVLH-CMGTGETKEEARRKAYELAEKVHFEG 78
5 -6.800d3d6nb2 c.78.1.0 (B:143-291) automated matches {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  9  4..DLRVLYVGDIKHSRVFRSGAPLLNMFGAKIGVCGPKTLIPRDVEVFKVDVFDDVDKGIDWADVV........ 67
6 -6.610d3lp8a3 b.84.2.0 (A:325-419) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}  ali model 3D-neighbors follow..  18  48...................................NNWVSDSGRVIN-VVAQGENLASAKHQAYAALDLLDWPD 85
7 -6.490d1gsoa1 b.84.2.1 (A:328-426) Glycinamide ribonucleotide synthetase (GAR-syn), C-domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  21  48...................................EQVVTNGGRVLC-VTALGHTVAEAQKRAYALMTDIHWDD 85
8 -6.470d1w96a1 b.84.2.1 (A:451-566) Acetyl-CoA carboxylase, BC-C subdomain {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  10  2GHCTACRITSEDPNDGPSGGTLHELNFRSFSVGNNGNIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRG 84
9 -5.540d2dk4a1 a.140.6.1 (A:8-70) Pre-mRNA-splicing factor 18 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  33  36...............................IRLFGETDYDAFQRLRKIEILTPEVNK................ 62
10 -5.310d2p12a1 b.175.1.1 (A:8-172) Hypothetical protein RHA1_ro00977 {Rhodococcus sp. RHA1 [TaxId: 101510]}  ali model 3D-neighbors follow..  17  98.....................LDLVVRTGRDTELLDVDELMEAHTTGLLD--TATAEQAILTATTAIDGIAAHG 148
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 5 5 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35