current user: public

If you have questions about the server, please let us know.

Query: d1ngka_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst KSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSPFLast
1 -72.500d1ngka_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]}  ali model 3D-neighbors  100  1KSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSPF 126
2 -60.100d2bkma_ a.1.1.1 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  38  4QTLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPD-DLTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDEI---GLSGPAREQFYHRLVLTAHHMVNTP. 124
3 -57.900d6bmea_ a.1.1.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}  ali model 3D-neighbors follow..  15  1STLHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFRGVDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLIINRGLNLTHFDKVAGHFVDSLKEM---GVGQELIDEAAGVLIGVRPLFDPER. 122
4 -57.100d2gkma_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}  ali model 3D-neighbors follow..  18  12ISIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTAA---GVPSETITEILGVIAPLAVDVTS... 127
5 -57.100d4i0va_ a.1.1.1 (A:) automated matches {Synechococcus sp. [TaxId: 32049]}  ali model 3D-neighbors follow..  18  1ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQEL---NVSQDLIDEVVTIVGSVQHDVLNR.. 123
6 -56.400d1dlwa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]}  ali model 3D-neighbors follow..  18  1.SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGR----NLKEVHANMGVSNAQFTTVIGHLRSALTGA---GVAAALVEQTVAVAETVRGDVVT... 115
7 -48.500d2ig3a_ a.1.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  11  1..MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNAEWKEHKAKIGNFWAGMLLGEGDYNGQP----LKKHLDLPPFPQEFFEIWLKLFEESLNIVYNEEMKNVILQRAQMIASHFQNMLYKYG. 125
8 -16.800d1tu9a1 a.1.1.2 (A:2-130) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  19  7MQSYGRCCASTGF---FDDFYRHFASSPQIRAKFATTDMTAQKHLLRAGIMNLVMYARGMSDSKLRAGASHSRAALDIRPELYDLWLDALLMAVAEHD-RDCDAETRDAWRDVMGRGIAVIKSY.. 128
9 -14.700d1or4a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  11  50.........QENIVNIVDAFYKNLDHESSLMDIINDHSVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKAFQELLLSMIDIYEASITNQQELLKAIKATTKILNLEQQLV.... 167
10 -12.500d3ubca_ a.1.1.0 (A:) automated matches {Methylacidiphilum infernorum [TaxId: 481448]}  ali model 3D-neighbors follow..  13  17.........EPNKNEIGLLFYANLKEEPTVSVLFQN-PISSQSRKLMQVLGILVQGIDNLEGIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAKAAWTKVYGIAAQVMT.... 130
11 -12.300d3wfwa1 a.1.1.0 (A:1-133) automated matches {Methylacidiphilum infernorum [TaxId: 481448]}  ali model 3D-neighbors follow..  10  17.........IDKMDEAGLLFYRRLDVEPKVRPLFK-IDIEKQGRKLMDVLNWIVLNLQDIDALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSEWTKQLEQLWTQAYEALAQVMIE... 131
12 -11.700d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}  ali model 3D-neighbors follow..  11ASTWKDIAGADNGAGVGKECLSKFSAHPEMAAVFGDPGVAELGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYGDISGALISG.. 144
13 -11.500d3ozua1 a.1.1.0 (A:1-150) automated matches {Ralstonia eutropha [TaxId: 381666]}  ali model 3D-neighbors follow..  12  18.........AEHGYDIIKCFYQRMEAHPELKNVFNHQEQGQQQQALARAVYAYAENIEDPNSMAVLKNIANKHASLGVKPEQYPIVGEHLLAAIKEVLGNAATDDIISAWAQAYGNLADVLMGM.. 136
14 -11.000d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  12KGVWKDVDHKQITAKALERVFV---VYPWTTRLFSDIGVQQHADKVQRALGEAIDDLKKVEIN---QNLSGKHQEIGVDTQNFKLLGQTFMVELALHYKKTFRPKEHAAAYKFFRLVAEALSSN.. 139
15 -10.600d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}  ali model 3D-neighbors follow..  12SKTFQGTDMKTVVTQALDRMFK---VYPWTNRYFQKRTDFRSSIHAGIVVGALQDAVKHMDDKTLFKDLSKKHADLHVDPGSFHLLTDCIIVELAYLRKDCFTPHIQGIWDKFFEVVIDAISKQ.. 134
16 -10.400d3qqqa_ a.1.1.2 (A:) automated matches {Trema tomentosa [TaxId: 3480]}  ali model 3D-neighbors follow..  11VKSWAVM--KKNSAELGLKFFLKIEIAPSAKNLFSNPKLKPHAMTVFVMTCESAVQLRKAGK----KRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPEMWSPEMKNAWGEAYDQLVAAIKSKP. 151
17 -10.200d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]}  ali model 3D-neighbors follow..  21RKTWHQL--MRNKTSFVTDVFIRIAYDPSAQNKFPSRQMQAHAIRVSSIMSEYVEELDSDILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGSDFNEKTRDAWAKAFSVVQAVLLVK.. 155
18 -10.200d2wy4a_ a.1.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  16.........QKNGEDLTNEFYKIMNDYPEVKPMFNKQISGEQPKALAMAILMAAKNIENLENRSFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNL---NPDEATLKAWEVAYGKIAKFYIDI.. 132
19 -9.940d1q1fa_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  15.........SRSPLEHGTVLFARLALEPSLLPLFQSPEFLDHIRKVMLVIDAAVTNVEDLSS----TSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTPATRTAWSRLYGAVVQAMSR... 144
20 -9.840d2xkia_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}  ali model 3D-neighbors follow..  13  2..........VNWAAVVDDFYQELKAHPEYQNKFGFKGVAKGNAAYKTQAGKTVDYINAAIGGSADAGLASRHKGRNVGSAEFHNAKACLAKACSAHGAPDLGHAIDDIL................ 107
21 -9.140d2w72a_ a.1.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  11KAAWGKV--GAHAGEYGAEAYERMLSFPTTKTYFPHFDLSHGSAQVKGQGKKVADALTNAVAHVDDSALSDLHAKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSK.. 139

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.