current user: public

If you have questions about the server, please let us know.

Query: d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst ATHKPINILEAFAAAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLALQLAAQIAGGPDLLEVGELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAPEWFDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVIGRMEAIAADTGCSIVFLHHASKGAAMMGAGDQQQASRGSSVLVDNIRWQSYLSSMTSAEAEEWGVDDDQRRFFVRFGVSKANYGAPFADRWFRRHDGGVLKPAVLERQRKSKGVPLast
1 -95.500d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors  100  1ATHKPINILEAFAAAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLALQLAAQIAGGPDLLEVGELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAPEWFDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVIGRMEAIAADTGCSIVFLHHASKGAAMMGAGDQQQASRGSSVLVDNIRWQSYLSSMTSAEAEEWGVDDDQRRFFVRFGVSKANYGAPFADRWFRRHDGGVLKPAVLERQRKSKGVP 274
2 -27.600d1cr1a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}  ali model 3D-neighbors follow..  13  23................TGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGT---------AMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLNDTFHLYDSFAEAETDRLLAKLAYMRSGL-GCDVIILDHISIVVSAESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEESITDLRGSGALRQLSDTIIALERNQQGDMPNL----------VLVRILKCRF................................ 253
3 -26.300d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  14...................KLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGG----EGKAMYIDTEGTFRP--ERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVE--SRYALLIVDSATALYRTDYSGRGELARFLRMLLRLADEFGVAVVITNQVVADGAAMFAADPKKPIGG-NIIAHASTTRLYLRKGRGET--------------RICKIYDSPCLPEAE-AMFAINADGVGDAKD........... 242
4 -21.100d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus elongatus PCC 7942 [TaxId: 1140]}  ali model 3D-neighbors follow..  12  17...................EMCGGGFFKDSIILATGATGTGKTLLVSRFVENACANKE----------RAILFAYEESRAQLLRNAYSWGMDF-----EEMERQNLLKIVCAYPESAGLEDHLQIIKSEINKPARIAIDSLSALARGVSNN--AFRQFVIGVTGYAKQEEITGLFT--------NTSDQFMGAHSITDSHISTITDTIILLQYVEIRG-----------EMSRAINVFKMRGSWHDKAIRFMISDKGPIKDSFRNFERIISGSP 239
5 -19.900d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus elongatus PCC 7942 [TaxId: 1140]}  ali model 3D-neighbors follow..  13  6.........AKMRTMIEGFDDISHGLPIGRSTLVSGTSGTGKTLFSIQFLYNGII---------EFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEVVGGFDLSALIERINYAIQRARRVSIDSVTSVFQQYDASS-VVRRELFRLVARLKQIGATTVMT---------TERIEEYGPIARYGVEEFVSDNVVILRNVLEGE-----------RRRRTLEILKLRGTSHMKGEYFTITDHGI................ 231
6 -18.400d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  49.......................GGLPMGRIVEIYGPESSGKTTLTLQVIAAAQR----------EGKTCAFIDAEHALD------PIYARKLGVDIDNLL------------SQPDTGEQALEICDALARSGAVIVVDSVAALTPKAEIEARMMSQAMRKLAGNLKQSNTLLIFINQIRMK--IGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGE-----NVVGSETRVKVVKNKIAAPFKQAEFQ...................... 256
7 -14.500d2vhja_ c.37.1.11 (A:) automated matches {Pseudomonas phage [TaxId: 161736]}  ali model 3D-neighbors follow..  13  122...........................ASGMVIVTGKGNSGKTPLVHALGEALG-----------GKDKYATVRFGEPLSGYNTD---------------------------------FNVFVDDIARAMLQHRVIVIDSLKNVIGAAGGNTTSAFDLLSDIGAMAASRGCVVIASLNPTSNDDKIVEKEASRANSTSLVISTDVDGEWQVLTRTGEGLQRLTQTSYGEHSVLTIHTSK................................... 300
8 -11.600d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  5................................FLTGPPGVGKTTLIHKASEVLSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSR.............................................................................. 188
9 -11.300d2d2ea_ c.37.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}  ali model 3D-neighbors follow..  15  24........................VVPKGEVHALMGPNGAGKSTL-----GKILAGDPEY---TVERGEILLILELSPDERARKGLFLAFQYPVEVPGVTIANFLRLALQAKLGREVGVAEFNEILQLLVLEPTYAVLDETDS--GLDIDALKVVARGVNAMR----GPNFGALVITHYQRILNYIQPDKVHVMMDGRVVATGGPELALELEAK............................................................ 236
10 -10.900d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]}  ali model 3D-neighbors follow..  12  3..............................QVAIYGKGGIGKSTTTQNLTSGLHA----------MGKTIMVVGCDPKADSTRLAQKSVLDTLREEGEDVELDSILKEGYGGGRGIITSINMLEQLGAYTDDLDYVFYDVLGDVASGEMMALYAANNISKGIQKYAKSGGVRLGGIICNSRKVANEYELLDAFAKELGSQLIHFVPRSPMVTKAEINKQTVIEYDPTCEQAEEYRELARK.................................. 243
11 -10.700d1yksa1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}  ali model 3D-neighbors follow..  2.........................LKKGMTTVLDFHPGAGKTRRFLPQILAECAR---------RRLRTLVLA---PTRVVLSEMKEAFHGLDVKFHTQAFSAHGSGREVIDAMCHATLTYRMLEPTRVVNWEVIIMDEA-------HFLDPASIAARGWAAHRARANESATILMTAT............................................................................................... 136
12 -10.700d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}  ali model 3D-neighbors follow..  14  1..........................MTTRMIILNGGSSAGKSGIVRCLQSVL-------------PEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVS--------IGPEFRALEGAWAEGVVAMARAGARIIIDDVF-----------GGAAAQERWRSFVGDLDVLWVGVR-AEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAW................................................... 170
13 -10.600d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  1..............................MILVTGGARSGKSRHAEALI--------------GDAPQVLYIASQILDDEMAARIQHHKDGRPAHWRTA-----------------CWRHLDTLITADLAPDDAILLECITTMVTNAAMERAIDDEIQILIAACQRCPAKVVLVTNEVGMGIVPENRARHFRDIAGNQRLAAAADEVWLV............................................................... 171
14 -10.600d1ihua2 c.37.1.10 (A:308-583) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  4..............DIPSLSALVDDINEHGLIMLMGKGGVGKTTMAAAIAVRLAD----------MGFDVHLTTSDDPHEETERYRQHVLETKGKELDEAGKRLLEEDLRSPCTEEIAVFQAFSRVIRE-AGKRFVVMDTAPTGHTLL-DATGAYHREIAKKMGEKGHFTTPMMLLQDPERTKVLLVTLPETTPVLEAANLQADLE.................................................................... 208
15 -10.500g1f2t.1 c.37.1.12 (A:,B:) Rad50 {Pyrococcus furiosus [TaxId: 2261]}  ali 3D-neighbors follow..  10  2.KLERVTVKNFRSHSDTVVEF------KEGINLIIGQNGSGKSSLLDAILVGLIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSSGEIHAMKRLVGNEW-FLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYL-----DEERRRKLITIMERYLKKIP-QVILVSH-------------------DEELKDAADHVIRISLENGSSKVEV.................................................... 291
16 -10.200d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  10  121.....................AVFEGLVNRRRILNLPTSAGRSLIQALLARYYLE---------NYEGKILIIVTTQMADDFVDMIKKIGGGASKDDKYKNDAPVVVGTW---------QTVVKQPKEWFSQFGMMMNDECHLATG-------------KSISSIISGLNNCMFKFGLSGSLRDGKANIMQYVGMFGE............................................................................ 278
17 -10.100d3tuic1 c.37.1.12 (C:1-240) automated matches {Escherichia coli K-12 [TaxId: 83333]}  ali model 3D-neighbors follow..  13  27........................HVPAGQIYGVIGASGAGKSTLIRCVN----------LLERPTEGSVLVDGQESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGNPKVLLCDQATSAL-----DPATTRSILELLKDINRRLGLTILLITH................................................................................................ 199
18 -9.880d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  11  4................................IITGEPGVGKTTLVKKIVERLAIGFWTEEVRDPETKKRTGFRIITTEGK-----KKIFSSKFFTSKKLVGSYGVNVQYFEELAIPILERAYREAKK--DRRKVIIIDEIGKMELFSKKFRDLVRQIMHDVKEIRRLPGAVLIELTPENRDVILE........................................................................................ 170
19 -9.800d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  17  22..........................MGRDYCVLLGPTGAGKSVFLELIA----------GIVKPDRGEVRLNGADITPLPPERRLRNVERVERDRRVREMAEKLGIAHLLDRKPARLSRQRVALARALVIQPRLLLLDPLSAV------DLKTKGVLMEELRFVQREFDVPILHVTHDLIEAAMLAD...................................................................................... 195
20 -9.620d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}  ali model 3D-neighbors follow..  13  44................................LLEGPPHSGKTAL----AAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKS---------------------------------------QLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAGRKLLIIGTTSRKDVLQ-----------EMEMLNAFSTTIHVPNIATGE........................................................ 178
21 -9.570d3ea0a1 c.37.1.0 (A:1-239) automated matches {Chlorobium tepidum [TaxId: 194439]}  ali model 3D-neighbors follow..  15  4..............................FGFVSAKGGDGGSCIAANFAFALSQEPDAVDISLPFGDLDMYLSGNTHSQDLADRLDKSLLDTMVQHISPSLDLIPSPATFEKIVNIEPERVSDLIHIAASFYDYIIVDFLCIVTTPSLQSLRRAGQLLKLCKEFEKPISRIEIILNRADTNSRITSDE..................................................................................... 189
22 -9.510d3l0ob2 c.37.1.0 (B:137-420) automated matches {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  14  29.....................LIDLFAPGQRGMIVAPPKAGKTTILKEIANGIAENHP-----------IILLIDE--------RPEEVTDIRESTNAIVIAAPFDMPPDKQVKVAELTLEMAKRLVEFNYDV-VILLDSLTRLARVYNIVVPPSGKFFGAARNTREGGSLTIIATALVETGSKMDEV---------FEEFKGTGNMELVLSRQLANKRIFPAIN................................................. 227
23 -9.460d1sgwa1 c.37.1.12 (A:2-200) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  12  22........................TIEKGNVVNFHGPNGIGKTTLLKTISLKPLKGEIIYGVPITKVKGKIFFLPEEII-KAVASLYGVKVNKNEIMDALESVEVLDLKKKLGELSQGTIRRVQLASTLLVNAEIYVLDPVVAI------DEDSKHKVLKSILEILKEKGIVIISSREELS............................................................................................. 186
24 -9.440d4p32a_ c.37.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}  ali model 3D-neighbors follow..  15  24........................TVNSGEIVGLLGPNGAGKTTTFYMVV----------GIVPRDAGNIIIISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMARDSMGQSLSGGERRRVEIARALAANPKFILLD--EPFAGVDPISVIDIKRIIEHLR----DSGLGVLITDH................................................................................................ 194
25 -9.440d4hzia_ c.37.1.0 (A:) automated matches {Leptospira interrogans [TaxId: 267671]}  ali model 3D-neighbors follow..  10  25........................EIKTNEHCVLLGRNGAGKSTLVNLIY----------GMIWATSGTIRLFQGEIAIQDLRKRIGILDSSQEETKTLQILKDSDLLSKKDQLYNTLSSGEKKKIRSIVNEPDFLIMDE-----PCSSLDLTAREDFLGFLKEYHSKKKFTSLYITH................................................................................................ 201
26 -9.380d3kb2a1 c.37.1.1 (A:2-165) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  1.............................TLIILEGPDCCFKSTVAAKLSKEL--KYPIIKGSSFE-------LAKSGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHAKKRLRVRGDEEGKDIDSILELYREVMSNAGLHTYSWDTGQWSSDE......................................................................................... 154
27 -9.310d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  12  28................PPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREAI----------KGGKSLYVVAGEKYESFKKRIGISTGDYESRDEHLGDCDIIVTTSEK-------DSLIRNRASWIKAVSCLVVDEIHLL--DSEKRGATLEILVTKMRRMNKALRVIGL.................................................................................................... 178
28 -9.260d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  15  2..........................LGGNILLLSGHPGSGKSTIAEALANLPGV-------------PKVHFHSDDLWGYIKHGRIDPWLPQSHQQNRMIMQIAADVAGR--LDGVVRPDWLPAFTALARPLHYIVLRTIERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINALQSGRFRI......................................................................... 175
29 -9.250d2nq2c_ c.37.1.0 (C:) automated matches {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  14  26........................DLNKGDILAVLGQNGCGKSTLLDLLLHRPIQGK-------IEVYQSIGFVPQFFSSPFAYSVLDIVKSHDYQVAMQALDYLNLTHLAKREFTSLSGGQRQLIRAIASECKLILLDE-----PTSALDLANQDIVLSLLIDLAQSQNMTVVFTTH................................................................................................ 186
30 -9.250d1gkub1 c.37.1.16 (B:6-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  12  36...........VGEPRAIQKMWAKRILRKESFAATAPTGVGKTSFGLAMSLFLAL---------KGKRCYVIFPTSLLVIQAAETIRKYAEKAGVGTENLIEKENFMQNLRNFKIVITTTQFLSKHYRELGHFDFIFVDDVDAILKASKNVDKLLHLLLKTKSWVGEARGCLMVSTATAKKGKKAELFRQLLNFDIGSSRIT........................................................................ 232
31 -9.240d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  10  4..............................IILTIGCPGSGKSTWAREFI--------------AKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQF--------------DTAKSILYGGDSVKGVIIS-----------DTNLNPERRLAWETFAKEYGWKVEHKV................................................................................................. 111
32 -9.230d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  16  73................DYQEKALERWLVDKRGCIVLPTGSGKTHVAMAAINEL------------STPTLIVVPTLALAEQWKERLGIF-----------------------------GEEYVGEFSGRIKELKPLTVSTYDSAYVNAEKLGNRFMLLI----------------VHHLPAESYVQIAQMSIAPFRGLTA.......................................................................... 203
33 -9.210d1vdza1 c.37.1.11 (A:60-113,A:191-439) A1 ATP synthase A subunit, central domain {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  14  82.....................VIDTFFPGGTAAIPGPFGSGKTVTQHQLA------------KWSDAQVVIYIGCGERGNEMTDVLEEFPKLKDPKTGKPLMERTVLIANTSNMPVAAREASIYTGITIAEYFRALMADSTSRW-------AEALREISGRLEEMPGEEGYPAYLASKLAEFYERAGRVVTLGSDYRVGSVS........................................................................ 252
34 -9.210d1wcv1_ c.37.1.0 (1:) automated matches {Thermus thermophilus [TaxId: 262724]}  ali model 3D-neighbors follow..  18  5..............................IALANQKGGVGKTTTAINLAAYLALGKRVLLVDLDPQGNATSGLGVRAERGVYHLLQGEPLEGLVHPVDGFHLLPATPDLVGATVELAGAPTALREALRDEGYDLVLLDTLNALAAAEG-ALEGVAGLLATLEEVRAGLNLGILVTMYDGRTLLAQQVEAQLRAHFGEKVFWTVIPRNVRLAEAPSFGKTIAQHAPTSPGAHAYRRLAEE.................................. 237
35 -9.060d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  10  11................................AILGGESSGKSVLVNKLAAVFNTGREFVFEKLGGDEQAM--QYSDYPQMALGHQRYIDYAVRHSHKIAFIDTDFITTQACIQYEGKAHPFLDSMIKEYPFDVTILLKNNTEWVDDGLGSQKQRQQFQQLLKKLLDKYKVPYIEIESPSYLDRYNQVKAVIEKVLNEEEISELQN.................................................................... 192
36 -9.000d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  12  27........................NIENGERFGILGPSGAGKTTFMRIIA-VPSTGELYFDDRLVASNGKLIVPPEDSKEEIRKRVEEVAKILDIHH---------VLNHFPRELSGAQQQRVALARALVKDPSLLLLDPFSNL------DARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIAD...................................................................................... 209

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.