current user: public

If you have questions about the server, please let us know.

Query: d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRVLast
1 -63.400d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}  ali model 3D-neighbors  100  1MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV 125
2 -34.400d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  1................GIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNI-DMLIPRDLRPAHPEYIRHNREGGKARVRELQLEKKDGSKIWTRFALSKVSAEGKVYYLVRD. 113
3 -30.500d2vv6a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]}  ali model 3D-neighbors follow..  17  1.........................IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNV-NILMPEPDRSRHDSYISRYRTTSDPHIRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFFVRDL 105
4 -26.200d1ll8a1 d.110.3.5 (A:8-114) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  1..........................NKAIFTVDAKTEILVANDKACGLLGYSSQDLIGQKL-TQFFLRSDSDVVEALSEEHMEADGVFGTVVDIISRSGEKIPVSVWMKRMRQERRLCCVLEPV 105
5 -26.200d2gj3a_ d.110.3.0 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]}  ali model 3D-neighbors follow..  17  4................EIFRQTVEHAPIAISITDLKANILYANRAFRTITGYGSEEVLGKN--SILSNGTTPRLVYQALWGRLAQKKPWSGVLVNRRKDKTLYLAELTVAPVLNEAGEYLGMHR. 113
6 -25.400d3sw1a_ d.110.3.0 (A:) automated matches {Pseudomonas putida [TaxId: 160488]}  ali model 3D-neighbors follow..  11  5................QLLQSMVDASNDGIVVAEKDTILIYVNAAFEYLTGYSRDEILYQDC-RFLQGDDRDQLGRARIRKAMAEGRPCREVLRNYRKDGSAFWNELSITPVKSDFDQRTIQKDV 119
7 -23.600d2z6ca_ d.110.3.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  16  1..............VSEDLKDALSTFQQTFVVSDPDYPIMYASAGFFNMTGYTSKEVVGRNC-RFLQGSGTDADELAKIRETLAAGNNYCGRILNYKKDGTSFWNLLTIAPIKDESG........ 105
8 -22.900d3f1pb_ d.110.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  1......................VCQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYS........ 95
9 -20.900d4r38a_ d.110.3.0 (A:) automated matches {Erythrobacter litoralis [TaxId: 314225]}  ali model 3D-neighbors follow..  16  1........................RLPFSLTIADDDEPLIYVNRAFEQMTGYSRSSVVGRNC-RFLQGEKTDPGAVERLAKAIRNCEEVEETIYNYRADGEGFWNHLLMGPLEDQDE........ 95
10 -20.600d4wn5a1 d.110.3.0 (A:237-343) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  1........................GRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHA-LDSDAVSKSIHTLLSKGQAVTGQYRFLARSGGYLWTQTQATVVSGGRG........ 92
11 -20.600d5svva_ d.110.3.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  16  1........................TAPCGFIVTDADQPIIYVNTVFEMVTGYRAEEVLGRNCRFLQCRGLVDSMVVSEIRKCIDEGIEFQGELLNFRKDGSPLMNRLRLTPIYGDDD........ 104
12 -19.900d4eetb_ d.110.3.6 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  2.........................IEKNFVITDPDNPIIFASDGFLELTEYSREEILGRNA-RFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKG........ 95
13 -19.800d4hoia1 d.110.3.0 (A:28-137) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  12  1...........................TNFVLGNADWPIVYSNDGFCKLSGYHRAEVMQKSSASFMYGELTDKDTVEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLF... 99
14 -19.500d4hqaa_ d.110.3.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  1..........................SRKFIIANANCAVIYCNDGFCELCGYSRAEVMQRPC-DFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMF... 100
15 -17.600d5f68a_ d.110.3.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  3.............................ISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKN........... 87
16 -12.400d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  11  5.............................MTKQDTTGKIISIDTSSRAAGRTGWEDLVRKCIYAFFQPQGEPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTR................. 85
17 -11.800d4e04a1 d.110.3.0 (A:13-126) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}  ali model 3D-neighbors follow..  15  20.............................LLALAADMTIVAGSDNLPELTGLAIGALIGRSAAD-VFDSETHNRLTIALAEPGAAVGAPIAVGFTMPDGERAFNGSWH................. 97
18 -9.590d4rq9a1 d.110.3.0 (A:16-130) automated matches {Stigmatella aurantiaca [TaxId: 378806]}  ali model 3D-neighbors follow..  20.............................LLVLSEPGVLTHASENAPAVLGNSAEQLLGAPL-GHFIEPSVREPLEADLRSARLKQLNPLKVVWRVDGVDRFFDGIAH................. 98
19 -9.210d3zq5a1 d.110.3.0 (A:2-130) automated matches {Synechocystis sp. [TaxId: 1148]}  ali model 3D-neighbors follow..  21  31.............................VVVLQEPDTISQISANCTGILGRSPEDLLGRTLGEVFDSFQ....................................................... 72

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.