current user: public

If you have questions about the server, please let us know.

Query: d1nzea_ a.24.18.1 (A:) Oxygen-evolving enhancer protein 3, {Spinach (Spinacia oleracea) [TaxId: 3562]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst FYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLGLast
1 -48.900d1nzea_ a.24.18.1 (A:) Oxygen-evolving enhancer protein 3, {Spinach (Spinacia oleracea) [TaxId: 3562]}  ali model 3D-neighbors  100  1FYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG 112
2 -7.950d1sr2a_ a.24.10.4 (A:) Sensor-like histidine kinase YojN, C-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  41..............VDTVPDDVKRLYTEAATSDFAALAQTAHR----LKGVFAML---------------LVPGKQLCETLEHLIREKDVPGIEKYISDIDSYVKSLL.... 116
3 -6.510d3ldqb1 a.7.7.1 (B:151-260) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  51............................................................CKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAEC. 101
4 -6.250d1k04a_ a.24.14.1 (A:) FAT domain of focal adhesion kinase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  13...SNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALA 121
5 -6.120d1ugoa1 a.7.7.1 (A:8-93) BAG-family molecular chaperone regulator-5, BAG-5 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  13  11.....SRLQEIQREVKAIEPQVVGFSGLSDDKNYKRLERILTKQL----FEIDSVDTEGKGDIQQARKRAAQETERLLKELEQNA........................... 86
6 -5.870d1m62a1 a.7.7.1 (A:376-457) Silencer of death domains, Sodd (Bag4) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  6.....KKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKEL----LELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKG........................... 81
7 -5.820d2nn5a1 d.129.3.5 (A:1-160) Hypothetical protein EF2215 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  11  80................................TWDTGIIYFDLKEQAPHQTLLVFSESLPENFTTPRHKDIAGWSIVLNRLKQVVETPDAAPEKIDFPQIENHYLEKLTNLE 159
8 -5.780d1y6da_ a.24.10.5 (A:) Phosphorelay protein luxU {Vibrio harveyi [TaxId: 669]}  ali model 3D-neighbors follow..  14  11.....................IEELSAEIGSD----VPVLLDIFLGEMDSYIGTLTELQGSEQLLYLKEISHALKSSAIAIDKKAKANQLQEQGMETSEMLALLHITRDAY. 109
9 -5.760d2f1ka1 a.100.1.12 (A:166-279) Prephenate dehydrogenase TyrA {Synechocystis sp. PCC 6803 [TaxId: 1148]}  ali model 3D-neighbors follow..  15  48.................................................RDTSRVGGGNPEYNQRALLKSLQDYRQHLDQLITLISNQQWPELHRLLQQTNGDRDKYVE... 114
10 -5.650d2a0ba_ a.24.10.1 (A:) Aerobic respiration control sensor protein, ArcB {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  12........................LEQYLELVGPKLITDGLAVFEKMMPGYVSVLESNLTAQDKKGIVEEGHKIKGAGQQIQSPDLPAWEDNVGEWIEEMKEEWRHDVEVL. 110

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35