current user: public

If you have questions about the server, please let us know.

Query: d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst KLASTMEGRVEQLAEQRQVIEAGGGERRVEKQHSQGKQTARERLNNLLDPHSFDEVGAFRKHRTTLFGMDKAVVPADGVVTGRGTILGRPVHAASQDFTVMGGSAGETQSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSLSGYGKMFFANVKLSGVVPQIAIIAGPCAGGASYSPALTDFIIMTKKAHMFITGPQVIKSVTGEDVTADELGGAEAHMAISGNIHFVAEDDDAAELIAKKLLSFLPQNNLast
1 -102.000d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}  ali model 3D-neighbors  100  1KLASTMEGRVEQLAEQRQVIEAGGGERRVEKQHSQGKQTARERLNNLLDPHSFDEVGAFRKHRTTLFGMDKAVVPADGVVTGRGTILGRPVHAASQDFTVMGGSAGETQSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSLSGYGKMFFANVKLSGVVPQIAIIAGPCAGGASYSPALTDFIIMTKKAHMFITGPQVIKSVTGEDVTADELGGAEAHMAISGNIHFVAEDDDAAELIAKKLLSFLPQNN 253
2 -75.000d3gf3a1 c.14.1.4 (A:3-291) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}  ali model 3D-neighbors follow..  17  24ENEQEIKAVESDIHESIKKAL-DAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPEN-------NKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGILSGMNNSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPA.. 289
3 -71.700d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  30  4........KCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHSLLDEGSLVELGSELKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQRGLPYISVLTDPTMGGVSASFAMGDLNIAEPKALIGFAGPRVIEQTVREKLP-PGFQRSEFLI-EKGAIDMIVRRPEMRLASILAKLMNLPAPN 262
4 -55.500d3tdca1 c.14.1.0 (A:1719-2042) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1....TPYVTKDLLQAKRFQAQTLGTTYIYDGSPDKYPKDILTYTELVLDSGQLVEMNRLPGGNEV------GMVAFKMRFKTQEYPEGRDVIVIGNDITFRIGSFGPGEDLLYLRASEMARAEGIPKIYVAANSGARIGLGVENLRGSGMIAGESSLAYEEIVTISLVTCRAIGIGAYLVRLGQRVIQVENSHIILTGASALNKVLGREVSNNQLGGVQIMH-YNGVSHITVPDDFEGVYTILEWLSYMPKDN 324
5 -37.500d2f9ia1 c.14.1.0 (A:1-314) automated matches {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  15  28DLQEEIDMLEASLERETKKIYTNLKPDRVQIARLQERPTTLDYIPYIFDSFMELHGDRNFR-------------DDPAMIGGIGFLNGRAVTVIGQQIYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFIDTKGAYPGKAAEERGQSESIATNLIEMASKVPVIAIVIGEGGSGGALGIGIANKVLMLENSTYSVISPEAAALLWKDSNLAKIAAETMKITAHDIKQLGIIDDIEQQALAIKSAF....... 283
6 -34.800d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}  ali model 3D-neighbors follow..  18  21...........................DIVPIDGKKGYDVRDVIAKIVDWGDYLEV---------------KAGYATNLVTAFARVNGRSVGIVANQPSVMSGCLDINASDKAAEFVNFCDSFNIPLVQLVDVPGGVQQEYGGIIRHGAKMLYAYSEAT--VPKITVVLRKAYGGSYLAMC-ADAVYAWPSAEIAVMGAEAANVIFRKEIKAAD--NTPYVAAARGQVDDVIDPADTRRKIASAL........ 244
7 -29.500d3gf3a2 c.14.1.4 (A:292-587) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}  ali model 3D-neighbors follow..  13  28................................NQKRPYDIYEVIARLFDNSEFSEY---------------KKGYGPEMVTGLAKVNGLLVGVIANVQGLIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGGDEAEKAELLGLGQSLIYSIENSK--LPSLEITIRKASAAAHYVLG-NVFSIGTGACEYYVMPGE-IIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFT........ 267
8 -21.000d3tdca2 c.14.1.0 (A:2043-2451) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  33...............................AGRPHPTLKGTWQSGFFDHGSFKEI---------------MAPWAQTVVTGRARLGGIPVGVIAVETRTVGQVWFPDSAYKTAQAIKDFNREKLPLMIFANWRGGMKDMYDQVLKFGAYIVDGLRQYK--QPILIYIPPYAELRGGSWVVIDIEMYADKESRGGVLEPETVEIKFRKKDLIKSMRRIDPAYKKLMEQLGEPDLSDKDRKDLEGRLK...... 263
9 -12.900d4jyla1 c.14.1.0 (A:1-243) automated matches {Thermoplasma volcanium [TaxId: 273116]}  ali model 3D-neighbors follow..  15  11..........................................................................................ASLIVLSRPEKLNAINLEMLADLADQFSKAEKEDTRVIVITGYGGADINMLASFDPASAYSFRLKMNRKSDKPVIALLKGYSMGGGLELAESADIRIAMSDAVIGQGGNVILPKLVGRGSAAYLA--NAQEAMALGLVDEVVDDEAKAWKIIDDICKKPK... 196
10 -12.700d4izba_ c.14.1.0 (A:) automated matches {Ruegeria pomeroyi [TaxId: 246200]}  ali model 3D-neighbors follow..  15  12....................................................................................DLRDNGVCVVTLNRPDKRNALDVATIEELVTFFSTAHRKGVRAVVLTGAGGLDLVEHWKADRSADDFMHVCLRWHEAFPIIAALRGAVVGGGLELASAAHLRVMDQSTYFALGATIRVSDMIGKYRMIDMI--QGQEAADLGLAQYITEGSDKAMELADKIASNLP... 207
11 -12.600d5dufa1 c.14.1.0 (A:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  10  10..........................................................................................VLTIELQRPERRNALNSQLVEELTQAIRKAGDGSARAIVLTGQGGADLSGDAFAADYPDRLIELHKAMDAPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFP-SSLVGHGRARAMLLSAEKLTAEIALHTGMANRIGTLAD-AQAWAAEIARLAP... 189
12 -12.300d3hp0a_ c.14.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  14  13..........................................................................................VCYITFHRPEANNTINDTLIEECLQVLNQCETSTVTVVVLEGLPGADFQEIYQEMKRGRKQASSQEPLYDLWVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSLPFLIRRIMTKPISVQE-------ASEWGLIDAFDAESDVLLRKHLLRLR...... 196
13 -12.100d2q35a1 c.14.1.0 (A:17-257) automated matches {Lyngbya majuscula [TaxId: 276768]}  ali model 3D-neighbors follow..  14  6....................................................................................ELGNGVVQITMKDESSRNGFSPSIVEGLRHCFSVVAQNQQYKVVILTGYGGASKEFLIRKTRGEVEVLDLSGLILDEIPIIAAMQGHSFGGGLLLGLYADFVVFSQESVYATATSLILREKLGSELAQEMI--RGKELAERGIPFPVVSRQDYAQQLGQKIAK...... 192
14 -11.900d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  11  14..........................................................................................VAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDIHELPSGGRDPLSYDDPLPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMVGIHNLTRDAGFHIVKELI--TAQRALAVGILNHVVEVEEFTLQMAHHISEKAP... 203
15 -11.800d2j5ia_ c.14.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  13  12....................................................................................EIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGGMDLKEYFREVDAGPEILQEKIRREAS-PTIAMVNGWCFGGGFSPLVACDLAICADEATFGLLVSKAMADTVGHRQSLMYI--GGQKAAEMGLVNESVPLAQVTIELARNLLEKNP... 211
16 -11.500d2gtra_ c.14.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  8....................................................................................RKQDGFTHILLSTKSSENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGGLDFIYFIRRLTDDRKRESTNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTP-PKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGQEVMVRIKELAS...... 203
17 -11.400d4kd6a_ c.14.1.0 (A:) automated matches {Burkholderia graminis [TaxId: 396598]}  ali model 3D-neighbors follow..  18  5....................................................................................SNHGRVAVITLNRPERLNAWTTPMRETIIDALERFNRDPEVAAIIMTGAGGQDLSEAHDFDGERAVAWVKTALRSLSKPLVMALNGTAAGSAFQVALLGDIRVGHPGVRMGQTGPWIMNAMLGMSRTIELT--EAEECHRIGLIHHLVDEDKKALEIATELAAKPP... 199
18 -11.200d4k3wa_ c.14.1.0 (A:) automated matches {Marinobacter aquaeolei [TaxId: 351348]}  ali model 3D-neighbors follow..  15  7....................................................................................EKQGPTLVITINRPDVRNAMSLQMVAELSTIFSEIENDISIRAAVLRGAGGGDIKDMAGARSQKAGEGRDDPFYK-SKVVIAITEGAVMGGGFGLACVSDLAIAGPTAKFGMPAPFVVERILGLRIDATE-------ACKLGIVHQVAESEEQLSDMLNQALERVRLCA 208
19 -11.100d3oc7a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 243243]}  ali model 3D-neighbors follow..  15  12....................................................................................ATGGPVARLTLNSPHNRNALSTALVSQLHQGLRDASSDPAVRVVVLAHTGGADLSEAGSGGSPSSAYDMAVERARERLPVIAAIDGHVRAGGFGLVGACDIAVAGPRSSFALTSLTLLPKLSARAAARYYLTGEKFDARRAGLITMAAEDDAAIDQLVTDVGRGSP... 208
20 -11.100d3qxza1 c.14.1.0 (A:3-260) automated matches {Mycobacterium abscessus [TaxId: 561007]}  ali model 3D-neighbors follow..  11  6....................................................................................EIRDGVAVLTLHGPSTRNSFTVELGRQLGAAYQRLDDDPAVRVIVLTGAPGAQISAAAETFAAPRNPDFSASPVQPAAPVIAAVNGHAIGIGMTLALHADIRILAEEGRYAIP-PRLVGTAVAAELLLTGASFSAQRAVETGLANRCLPAGKAALRMAHDIAT...... 196
21 -11.100d3i47a1 c.14.1.0 (A:4-260) automated matches {Legionella pneumophila [TaxId: 272624]}  ali model 3D-neighbors follow..  13  6....................................................................................EIQDKVGLLTMNRISKHNAFDNQLLTEMRIRLDSAINDTNVRVIVLKANGGADLTWMQSMANFTEEENLEDSLVLGNLPTIAMVQGAAFGGGAGLAAACDIAIASTSARFCFVISPYVVRAIGERAAKMLF--DATRAYSLNLVQHCVPDDTFTLKYASQISNNAP... 202
22 -11.100d4k29a_ c.14.1.0 (A:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}  ali model 3D-neighbors follow..  15  8....................................................................................ETLHGVARITLNRPERTNALDQEMLGEINAAMDAAEADAGVKAVIVRGAGGFDLKAQMEARPAGVDAWRPLLRKDFDTPTIAAVRGPCLAGACELALACDMTIATEDAFFGEIVVMLLPWIVGPKIAKEII--PARRAAEIGMVNRVVDGDGEALRIARHIGAIDP... 203
23 -11.100d4jota1 c.14.1.0 (A:1-253) automated matches {Deinococcus radiodurans [TaxId: 243230]}  ali model 3D-neighbors follow..  16  22..........................................................................................GTVATLTLAAKMGSMGPAFWQEFPQALSELGDARVLIVR---SAGLDVKSNGAAIVPALGKPDAFKAVVDEMPVIAAVHGWCIGAGLELIAGADLRLCSQDARFSLP-PHLIGRGRTAHLALTGEAIDAATAERWGLVTEVLPDQDALFARAEALAEHLAALP 213
24 -11.000d4k2na1 c.14.1.0 (A:1-259) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  18  8....................................................................................VREGAIATVTLNRPDRMNALNLPMWRGLAEAFETISADRSIHVVILRGAGGADIEEFDTLRANAEQAKAYDLVMRKALPVIAAIWGPCVGGGLELACCCDIRLSAKSGKFGVPELAQIRRVAGPAAALEIL--DADEAAAKRLVNRVVEDDAEVAATAKRIAAGAP... 205
25 -11.000d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]}  ali model 3D-neighbors follow..  15  10..........................................................................................VRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNEVKQLSRSQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMVGAAILGFTHGFSTMQEII--DAPRCVDYRLVNQVVESSAAAITQAHVMASYPA... 200
26 -10.900d3gowa_ c.14.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}  ali model 3D-neighbors follow..  14  5....................................................................................ERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGGQDLTEFGDRKPDYEAHLRRYNRVVEALPLVVAVNGVAAGAGMSLALWGDLRLAAVGASFTTA-PRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKEALSLAKELAQ...... 195
27 -10.900d4moua_ c.14.1.0 (A:) automated matches {Arthrobacter aurescens [TaxId: 290340]}  ali model 3D-neighbors follow..  16  11....................................................................................AIADGVASVEISNLAQRNALTKDMCLEIQELMPQLDADPDVAVVVLRGAGGASISELASVLLDPQPDGSTADHLSRADPAVALVDGACMGGGWQIASACDFIIANERAVIGLPGLERLVRLVGHANAKYIL--SAPEARALGLVADVVPSESKCAALVRSLRSRSR... 207
28 -10.900d4jfca_ c.14.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}  ali model 3D-neighbors follow..  14  1...................................................................................GAIEGQTLILTLSNPEFRNALGPEIYAAGIEALNAAENNPEIRSVVITGEGGGNLQRLQANRREAPEVQAQSIEGLHNWPVIAAVEGAAAGAGFSLALACDFVVAASNAVFVMS-ARSLPRALASELLMGGERISAQRLHDLGLVNKVASAGDEALRMAGQLNARAP... 203
29 -10.900d5c9ga1 c.14.1.0 (A:2-260) automated matches {Hyphomonas neptunium [TaxId: 228405]}  ali model 3D-neighbors follow..  15  7....................................................................................DIAAPLAEIVLNKPERRNALSVDMWAAIPGLVAEANANPDVKLILIHGGDGADISEFETIYATEDAAKASGQRIAQALPVIAAIEGACVGGGVSLAMAADLRVAGEGAKFGVGDTRRLLAAVGPGATKDIL--TAGEAKSLGLIDRLVEKGTAARVWAGEIAAISQ... 204
30 -10.800d4qfea1 c.14.1.0 (A:2-229) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  16  7....................................................................................ERNGPVTTVIIDRPEARNAVNGPTAAALFAAFEEFDADDTASVAVLTGANGADLKAEANQVHREGPGPMGPSRMDLSKPVIAAISGYAVAGGLELALWCDLRVVDEDATMGVGGTVRLPRLIGHSRAMDLI--DAAEAYAIGLANRVVPTGQAAEELAADLARLPQ... 199
31 -10.800d4wcza_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  13  6....................................................................................ERDGAVARLLIDRADRRNAFSLDMWQRLPELLAEASGDDALRVLVVKSANGADIAELLANKDDAAFHAANQQAINRAQPTVAMVEGDCIGGGCGIALACDMRIAAPAARFGIHDVKLLVDLVGPGQARRLMFTGANEAHRIGLVELLGESEDALVGQLAT......... 194
32 -10.800d3fdua1 c.14.1.0 (A:10-255) automated matches {Acinetobacter baumannii [TaxId: 400667]}  ali model 3D-neighbors follow..  15  7....................................................................................NLEGGVLTLAINRPEAKNALYGELYLWIAKALDEADQNKDVRVVVLRGAEGNDMKDFMGFVQNPNAGPAGQVPPFVLLPLIIAVKGVAIGIGVTILLQADLVFADNTALFQIGASQLLVKQAGYHKAAELL--NAETALQAGLVNEIVEDAYATAQATAQHLTALP... 200
33 -10.700d3rrva_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  14  10....................................................................................RADGALRIITLNRPDSLNSVNDDLHVGLARLWQRLTDDPTARAAVITGAGGGDFGYLKELSADADLRAKTIRDGREIVPVVAAVNGPAVGLGCSLVALSDIVYIAENAYLADP-PLHISLLLAKEYALTGTRISAQRAVELGLANHVADD-AEAIACAKKILELPQ... 204
34 -10.700d4neka_ c.14.1.0 (A:) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  14  7....................................................................................HVEGGVQVVRMNRPDKKNALIGEMYAALAEAFAKGEADDDVNVFLILGSQGNDLPDFLTWEALSGSVADRFIRAVAGAPVVAAVRGAAIGIGSTLLPHCDLVYAAPGTRFHMGSSQTMPALAGHRRAAEML--GVDTAEAVGLINGVVPGEDTAMAAARKLAA...... 194
35 -10.700d4jcsa1 c.14.1.0 (A:1-264) automated matches {Cupriavidus metallidurans [TaxId: 266264]}  ali model 3D-neighbors follow..  13  7....................................................................................EVVNNVGWIRMNRAAKHNPFDAELRADLMTVLERVRDDADIRVLVLTSHPGGNLHVLRDNLDSGPAYWQQRIKTGLRFPVIAAVDGPAFGAGFALSLTADIVLASPRARFSMA-PRAVGLQRAKELMFSTRELDAEEAHRLGLVMEVHESEARAREIAESLVQAAP... 204
36 -10.700d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  12  20..........................................................................................VLEITFRGEKLNAMPPALHRGLARVWRDLEAVEGVRAVLLRGEGGGSFGLIEEMRASHEALLRVFWEARDLVPVVAAVEKVAVGAGLALALAADIAVVGKGTRLLDG-PLLVGMALNEPLTGEE-------AERLGLVALAVEDEKKALEVAERLAQ...... 207
37 -10.500d4og1a_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  16  13....................................................................................TIEDHVAHVLLDRADKMNALDDAMFEGIVAAGHHLHSVKGVRCVVLSGAGGLDLSSMGRTDRWSGNSLTERTHGNANMPVIAAVHGVCFGGGLQVASGADIRFITPDARLAVM-RGNVRDDVLRELTYTHREFSGEEAVRFGFATHVADD-AGAMELARVVAEKSP... 212
38 -10.500d4lk5a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 262316]}  ali model 3D-neighbors follow..  14  10....................................................................................TLSDGVFSVTINRPDSLNSLTVPVITGIADAMEYAATDPEVKVVRIGGAGGAGISADDVSDGGGVPPDEIILEINRLVPVVAVVQGPAAGVGVSIALACDVVLASENAFFMLA-AAAVGRIRAMQMALLPERLPAAEALAWGLVTAVYPADEEVDKVIARLLS...... 203
39 -10.500d4jwva1 c.14.1.0 (A:3-257) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  15  6....................................................................................RIEGHVAHVRLNRPQGLNAITQEMDDLLLDAWTEVNANSDIWAVVLSAEGGADVSGGAERKTRMALGGGLTGIGGPKKPMVAAVQGFCVGGGFELAMCADIIVAADTAQFGLGVVHRAMRQLPYHIALQLI--KADEARHYGLVNEVVPFAEAALRWASKLNAASP... 199
40 -10.400d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]}  ali model 3D-neighbors follow..  12  14..........................................................................................VAVMKFKNPPVNSLSLEFLTELVISLEKLENDKSFRGVILTSDAGLDLTEMCGRSPAHYAGYWKAVQYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYCIGLNETLENTIGHRAAERAL--PPAEALQVGIVDQVVPEEQTALSAIAQWMA...... 202
41 -10.400d3pe8a_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  14  7....................................................................................DTTDRVRTLTLNRPQSRNALSAELRSTFFRALSDAQNDDDVDVVIVTGADGLDLKE-LGDTTELPDISPKWPDMTK--PVIGAINGAAVTGGLELALYCDILIASENAKFADT-PQKVGVGLARRMSLTGDYLSAQDALRAGLVTEVVAHDDAARRVAASIVGNNQ... 192
42 -10.300d5e0nx_ c.14.1.0 (X:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  14  8....................................................................................RSRPGVALVTLNRPERMNSMAFDVMVPLLELLGDLRHDNSVRVVILTGAGGADHKSAGSVPHVDGLTRPTYALRRLHQPVIAAVNGAAIGGGLCLALACDVRIAAHNAYFRAA-PRAIGTSRAFEIMLTGRDVDAAEAERIGLVSRTVPDDDTCFEMAQRMRGFSR... 210
43 -10.200d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  13..........................................................................................ITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSIITVLTGNGGNDLTNFTDIPPGGVEEKAKGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTP-PKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTEVWTRLKAFAK...... 202
44 -10.200d3swxa_ c.14.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 36809]}  ali model 3D-neighbors follow..  10  8....................................................................................RRDGYVLVIGLNRPAKRNAFDKTMLEELALALGEYETDTDLRAAVLYGEGGLDLASVAAEIQGGASLTPEVDGRQLSKPLLVAVHGKVLTLGIELALAADIVIADETATFAQGATIRFPRTAGWGNAMRWM--DAVEAHRIGIVQEIVPVGETAIAIAQTIARQAP... 203
45 -10.200d4qiia_ c.14.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  16  40........................................RPEVRNAFRPHTVDELYRVLDHARMSPDVGV-------LLTGNGP-DGGWAFCSGGDQRIRGRSGYQYASGDTADTVDVARAGRLHILEVQR-----------------------LIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFGYGSAYLARQVGQKFAREIF--TAEQMHQMGAVNAVAEHAEVGLQWAAEINAKSP... 241
46 -10.200d4f47a_ c.14.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}  ali model 3D-neighbors follow..  16  7....................................................................................EQRGHTLIVTMNRPSRRNALSGEMMQIMVEAWDRVDNDPDIRCCILTGAGGMDLKAATKKPPGDSFKDGSYDPSRIDAPLIAAVEGPAIAGGTEILQGTDIRVAAESAKFGIGSAVRLVRQIPYTVACDLL--TAAEAKEMGLVGHVVPDGQKALEIAEIIAANGP... 204
47 -10.100d3myba_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  18  8....................................................................................RDERGVVTLTLNRPQAFNALSEAMLAALGEAFGTLAEDESVRAVVLAASGGHDLKEAEPSREYYEKLFARCTDVMLAIPVIARVHGIATAAGCQLVAMCDLAVATRDARFAVPGVALSRNVTGEFVSADD-------AKGLGLVNRVVAPKAEIEAMVSKIVAKPR... 202
48 -10.100d5jbxa_ c.14.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 246197]}  ali model 3D-neighbors follow..  14  7....................................................................................DARGPIEIWTIDGESRRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGGADLKERATMAEDEVRAFLDGLREKSDCVFIAAINGAALGGGTELALACDLRVAAPAAELGLGGTQRLARLVGPGRAKDLI--NAAEAFSVGLANRLAPEGHVAYGLAESVVENAP... 202
49 -9.950d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  18  14..........................................................................................VLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMASDILQPPGDDVARKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVGTLQRLPKVIGNRSLVNEL--MADEALDSGLVSRVFPDKDVMLNAAFALAADISSKS 215
50 -9.850d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]}  ali model 3D-neighbors follow..  11  8....................................................................................RVEDGVAEITIKLPRHRNALSVKAMQEVTDALNRAEEDDSVGAVMITGAEGFYLREIPLDKGVAGVRDHFRIAALWKRPVLAAINGVAAGGGLGISLASDMAICADSAKFVCA-ARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEVAWKVARELAA...... 204
51 -9.780d3tlfa_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  15  9....................................................................................EVDGHTATITLNRPDALNALSPHMITELRAAYHEAENDDRVWLLVVTGTGGADVKEIPEDGKVIYERPYLSTYRTMAKPVLTAVNGICCGAGMDWVTTTDIVIASEQATFFDRELVRVSRVLPRSIALRMA--SAQRAYELGLISEIVEHDRRAHEIADIVNSNAP... 211
52 -9.600d3moya_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  13  10....................................................................................RPVAGVGLIRLDRPDALNALNQTLEAEVLDAARDFDADLEIGAIVVTGSEGADIAEMVTLTPHQARERNLLSGWDSRKPIVAAVAGYALGGGCELAMLCDLVIAADTARFGQGGTQRLTRAVGKAKAMDLC--TAEEAERVGLVSRIVPAADEALAVAQRIARMSR... 202

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.