current user: public

If you have questions about the server, please let us know.

Query: d1plqa2 d.131.1.2 (A:127-258) Proliferating cell nuclear antigen (PCNA) {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst KIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEELast
1 -72.800d1plqa2 d.131.1.2 (A:127-258) Proliferating cell nuclear antigen (PCNA) {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors  100  1KIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE 132
2 -64.100d1u7ba2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  33  2.IPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADGHLKYYLAPKI.... 129
3 -61.700d3p91a2 d.131.1.0 (A:128-254) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}  ali model 3D-neighbors follow..  31  1EIPELQSDAIITLSSAEFLKITKDFSALGDDITIGCTKNEVTLTTKGAMCETCMTLSALENV--DSNGLQIEHNKDVTASFALKQISEFAKSAPLADNVKLSLSGQAPLIMEFKGEACVLKFYLAPKF.... 127
4 -58.400d1rwza2 d.131.1.2 (A:123-244) Proliferating cell nuclear antigen (PCNA) {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  21  1..PELELPAKIVMDAGEFKKAIAAADKISDQVIFRSDKEGFRIEAKGDVDSIVFHMTETE--------LIEFNGGEARSMFSVDYLKEFCKVAGSGDLLTIHLGTNYPVRLVFELVGAKVEYILAPRIES.. 122
5 -57.000d1iz5a2 d.131.1.2 (A:126-246) Proliferating cell nuclear antigen (PCNA) {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  23  1..PELPFTAKVVVLGEVLKAAVKAASLVSDSIKFIARENEFIMKAEGETQEVEIKLTLEDEGL-----LDIEVQEETKSAYGVSYLSDMVKGLGKADEVTIKFGNEMPMQMEYYIRDGRLTFLLAPR..... 121
6 -56.800d3ifva2 d.131.1.2 (A:113-243) Proliferating cell nuclear antigen (PCNA) {Haloferax volcanii [TaxId: 2246]}  ali model 3D-neighbors follow..  17  9DIPDLDLAANIVLEGTHLDRGIKAADMVSDHIRLRVDGAEETFHIEAEGDTDDVDLSLPPAD------LISIEAGAADSLFSLDYLKDMNKAIPTDAEVTVELGEEFPVKLHYQIAEGTITYMLAPR..... 131
7 -56.100d2ix2b2 d.131.1.0 (B:127-245) automated matches {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  21  1.....EFPFKAQLLTITFADIIDELSDLGEVLNIHSKENKLYFEVIGDLSTAKVELSTDNGT------LLEASGADVSSSYGMEYVANTTKMRRASDSMELYFGSQIPLKLRFKLPQGYGDFYIAPRAD... 119
8 -54.900d1ud9a2 d.131.1.2 (A:127-245) Proliferating cell nuclear antigen (PCNA) {Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  20  1.....EFDIKATINASGLKNAIGEIAEVADTLLISGNEEKVVVKGEGENKVEVEFSKDTGSL------ADIEFNKESSSAYDVEYLNDIISLTKLSDYVKVAFADQKPMQLEFNMEGGKVTYLLAPKLS... 119
9 -17.200d1iz5a1 d.131.1.2 (A:2-120) Proliferating cell nuclear antigen (PCNA) {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  17  8.............GAKEFAQLIDTASKLIDEAAFKVTEDGISMRAMDPSRVVLIDLN-----LPSSIFSKYEVVEPETIGVNLDHLKKILKRGKAKDTLILKKGEENFLEITIQ--GTATRTFRVPLIDVEE 119
10 -16.700d1rwza1 d.131.1.2 (A:1-122) Proliferating cell nuclear antigen (PCNA) {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  13  3.........DVIMTGELLKTVTRAIVALVSEARIHFLEKGLHSRAVDPANVAMVIVD-----IPKDSFEVYNIDEEKTIGVDMDRIFDISKSISTKDLVELIVEDESTLKVKFGSVEYKVALI-EPRI.... 122
11 -16.400d3aixa1 d.131.1.0 (A:1-126) automated matches {Sulfolobus tokodaii [TaxId: 273063]}  ali model 3D-neighbors follow..  14  4..........KVIDADAFSYIFRTLEEFIDEITLDFTSDGLKIRGIDPSRVTFIDIL-----IPAGYFEEYNVEKEEKVGVKLEDFTDVLKTVTKNDSLYLETDENQNIKVTFTFPSIVASEIETPNLN... 125
12 -16.100d1ud9a1 d.131.1.2 (A:1-119) Proliferating cell nuclear antigen (PCNA) {Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  15  7.............DVRDLKAIIQALLKLVDEALFDIKPEGIQLVAIDKAHISLIKIELPKEMFK-----EYDVPEEFKFGFNTQYMSKLLKAAKRKEEIIIDADSPEVVKLTLS--GALNRVFNVNNIEVLP 118
13 -15.400d5w7za3 d.131.1.0 (A:249-379) automated matches {Rickettsia conorii [TaxId: 272944]}  ali model 3D-neighbors follow..  19  4.IPE-SSSSKLVINRKMFADSIERIAIITVEVKLSLSRETLEISAVGARGNAKEVINSS---QDKESFYEYNSDESLAIGFNPQYLEDVLKAVK-SDVVELYFSDVSAPVLIKFPENPKDIFVVMP...... 128
14 -14.600d3p91a1 d.131.1.0 (A:1-127) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}  ali model 3D-neighbors follow..  13  10.............EAALFKRVVESLKSTIDKTNFDCSDAGIAVQCMDNSHVSLVSLL-----IETDAFDEFQCLKPITLGINLTHLSKILKALDNDCGLILDVKKVDDAVLSITSEGNKTMKFGLNLVDIEA 124
15 -13.500d4k3la3 d.131.1.1 (A:245-365) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  4.LPK-NPDKHLEAGCDLLKQAFARAAILSNEVRLYVSENQLKITANNEQEEAEEILDVTYS------------GAEMEIGFNVSYVLDVLNALK-CENVRMMLTDSVSSVQIEDAASQSAAYVVMP...... 119
16 -13.300d1u7ba1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  8.............QGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLT-----LRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDN.......................... 95
17 -13.200d1vpka3 d.131.1.1 (A:244-366) DNA polymerase III, beta subunit {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  11  4.IPE-TFKTKVVVSRKELRESLKRVMVIASKVKFEIEENVMRLVSKSDYGEVVDEVEVQKE------------GEDLVIAFNPKFIEDVLKHIE-TEEIEMNFVDSTSPCQINPLDISGYLYIVMP...... 119
18 -13.200d1plqa1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  18  8.............EASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLE-----IGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNT.......................... 95
19 -13.200d5wcea3 d.131.1.0 (A:251-372) automated matches {Caulobacter crescentus [TaxId: 190650]}  ali model 3D-neighbors follow..  18  4.IPR-DNAKILTLDNDLFAKAVDRVATISAEVKLAVEPGRITLTVRNEAGQAVEEVEVDYD------------GEPFEIGFNARYLLDVCGQIA-GPQAEFRFADPASPTLVVDPVDPGVKYVLMP...... 119
20 -13.100d3ifva1 d.131.1.2 (A:2-112) Proliferating cell nuclear antigen (PCNA) {Haloferax volcanii [TaxId: 2246]}  ali model 3D-neighbors follow..  13  2.........KAIVSAATLRDALDSVSVLVDECKIRLNEESLSIRAVDPANVGMVDLTLDAAAFESYEA------HGGVIGVNLSRLEEVAGMAGAGDLIHLTLDEET-LNIRIDGLSYTLALI......... 110

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Shiryaev SA, Ratnikov BI, Chekanov AV, Sikora S, Rozanov DV, Godzik A,Wang J, Smith JW, Huang Z, Lindberg I, Samuel MA, Diamond MS, Strongin AY. Cleavage targets and the D-arginine-based inhibitors of the West Nile virus NS3 processing proteinase. Biochem J. 2006 Jan 15;393(Pt 2):503-11.