current user: public

If you have questions about the server, please let us know.

Query: d1qd1a1 d.58.34.1 (A:2-180) Formiminotransferase domain of formiminotransferase-cyclodeaminase. {Pig (Sus scrofa) [TaxId: 9823]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst SQLVECVPNFSEGKNQEVIDAISRAVAQTPGCVLLDVDSGPSTNRTVYTFVGRPEDVVEGALNAARAAYQLIDMSRHHGEHPRMGALDVCPFIPVRGVTMDECVRCAQAFGQRLAEELGVPVYLYGEAARTAGRQSLPALRAGEYEALPEKLKQAEWAPDFGPSAFVPSWGATVAGARKLast
1 -105.000d1qd1a1 d.58.34.1 (A:2-180) Formiminotransferase domain of formiminotransferase-cyclodeaminase. {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors  100  1SQLVECVPNFSEGKNQEVIDAISRAVAQTPGCVLLDVDSGPSTNRTVYTFVGRPEDVVEGALNAARAAYQLIDMSRHHGEHPRMGALDVCPFIPVRGVTMDECVRCAQAFGQRLAEELGVPVYLYGEAARTAGRQSLPALRAGEYEALPEKLKQAEWAPDFGPSAFVPSWGATVAGARK 179
2 -7.300d3rcma1 c.1.9.0 (A:1-268) automated matches {Pseudomonas putida [TaxId: 160488]}  ali model 3D-neighbors follow..  17  2.QLIDIGVNLTNSSFHDQQAAIVERALEAGVTQMLLTGTSLAVSEQALELCQQLDASGAHLFATA-------------GVHPRVRAVGECGLDFNRDFSPRPLQEKALEAQLTLAAQLRLPVFLHERDASERLLAILKDYRDHLTGAV............................... 156
3 -6.600d1j6oa1 c.1.9.12 (A:0-255) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  10  1..MVDTHAHLHFHQFDDDRNAVISSFEENNIEFVVNVGVNLEDSKKSLDLSKTSDRIFCSV-DAKEVPEDFIEHLEKFAKDEKVVAIGETGLDFFRNISPAEVQKRVFVEQIELAGKLNLPLVVHIRDAYSEAYEILRTESLPEKRGV............................... 150
4 -6.450d2gzxa_ c.1.9.0 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}  ali model 3D-neighbors follow..  10  1..LIDTHVHLNDEQYDDDLSEVITRAREAGVDRMFVVGFNKSTIERAMKLIDEYDFLYGII-DAIDFTEEHLEWIESLAQHPKVIGIGEMGLDYHWDKSPADVQKEVFRKQIALAKRLKLPIIIHNREATQDCIDILLEEHAEEVGGI............................... 150
5 -6.110d1t3ta4 d.79.4.1 (A:221-429) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  10  10..........GKPQPKSLFKMIKNTFETTPDYVLSAYKDNAAVMEGSAVGRYFADHNTGRYDFHQEPAHILMKVETHN--HPT-------AISPWPGAATGSGGEIRDEGATGRGAKPKAGLVGFSVSNLRIPGFEQPWEEDFGKPERIVTALDIMTEGPLGGAAFNNEFGRPALTG.. 167
6 -6.060d3sgha_ a.118.8.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}  ali model 3D-neighbors follow..  10  78..........NSTEKKGVIYAMAQLTRVYGMQLLASLQGPIPYTQMTEAPYDNEQTVWHAMFDDLDNAITILKSAATFGVNQDLAVVDQF------KGDCSKWLKFANTLKLRMAIRIS............................................................ 185
7 -5.980d1fm0e_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  16................EEYPWLAERDEDGAVVTFTGKVRNHNLGDSVLTLEHYPGMTEKALAEIVDEARNRWPLGRVTVIH-RIGELDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPF........................................................... 123
8 -5.790d2v0na3 d.58.29.2 (A:294-454) Response regulator PleD, C-terminal domain {Caulobacter crescentus [TaxId: 155892]}  ali model 3D-neighbors follow..  12  11..............TGQLDSLVKRATLGGDPVSALLI--DIDFFKKINDTFGHDDEVLREFALRLASNVRAIDL--------RYGGEEFVVIMP--DTALADALRIAERIRMHVSGS.............................................................. 105
9 -5.560d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  18  63..............APHMVAIMLEIANLKPGMNILEVGTGSGWNAAVYTIERIPELVEFAKRNLERAGVKNVHVILGDG---SKGFPPKAPYDVI-------VTAGAPKIPEPLIEQLKIGGKLIIPVGSYHLWQELLEVRKTKDGIKIKNHGGVAFVPLIG................. 210
10 -5.420d2omda_ d.41.5.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}  ali model 3D-neighbors follow..  11  3...VGMIPRVYLGHEWFGAERILSEYQVPEDCGAQVLFLGIPRNAEALEYEAYPEMAIKEMEKIRQETIEKFGVKEVFIHH-RLGLVEPSFLVLAVGGHREETFKACRYAVDETKKRVPI........................................................... 128

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.