current user: public

If you have questions about the server, please let us know.

Query: d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MDIKVHFHDFSHVRIDCEESTFHELRDFFSFEADGYRFNPRFRYGNWDGRIRLLDYNRLLPFGLVGQIKKFCDNFGYKAWIDPQINEKEELSRKDFDEWLSKLEIYSGNKRIEPHWYQKDAVFEGLVNRRRILNLPTSAGRSLIQALLARYYLENYEGKILIIVPTTALTTQMADDFVDYRLFSHAMIKKIGGGASKDDKYKNDAPVVVGTWQTVVKQPKEWFSQFGMMMNDECHLATGKSISSIISGLNNCMFKFGLSGSLRDGKANIMQYVGMFGEIFKPLast
1 -104.000d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors  100  1MDIKVHFHDFSHVRIDCEESTFHELRDFFSFEADGYRFNPRFRYGNWDGRIRLLDYNRLLPFGLVGQIKKFCDNFGYKAWIDPQINEKEELSRKDFDEWLSKLEIYSGNKRIEPHWYQKDAVFEGLVNRRRILNLPTSAGRSLIQALLARYYLENYEGKILIIVPTTALTTQMADDFVDYRLFSHAMIKKIGGGASKDDKYKNDAPVVVGTWQTVVKQPKEWFSQFGMMMNDECHLATGKSISSIISGLNNCMFKFGLSGSLRDGKANIMQYVGMFGEIFKP 282
2 -52.500d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  20  32..........................................................RALAFRYRDIIEYFESNGIEFV----------------DNAADPIPTPYFDAEISLRDYQEKALERWLVDKRGCIVLPTGSGKTHVAMAAI----NELSTPTLIVVPTLALAEQWKERLGIFG---EEYVGEFSGRIKE------LKPLTVSTYDSAYVNAEKLGNRFMLLIFDEVHHLPAESYVQIAQMS-IAPFRLGLTATFE................... 206
3 -47.600d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  26  7..............................................................................................................LIQPRIYQEVIYAKCKE-TNCLIVLPTGLGKTLIAMMIAEYRLTKYGGKVLMLAPTKPLVLQHAESFRRLFNLPPEKIVALTGEKSPEERSKARAKVIVATPQTIENDLLA-LEDVSLIVFDEAHRAVGNYAYVFIARQAKNPLVIGLTASPGSTPEKIMEVINNL...... 180
4 -35.500d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  21  25................................................................................................................ELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREAIK-GGKSLYVVPLRALAGEKYESFKKWEKI-GLRIGISTGDYESRDEHLGDCDIIVTTSESLIRNRASWIKAVSCLVVDEIHLLRGATLEILVTKMNKALRVIGLSATAPNVTE............... 187
5 -26.700d1yksa1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}  ali model 3D-neighbors follow..  11  4..............................................................................................................................KGMTTVLDFHPGAGKTRRFLPQILAECARRRLRTLVLAPTRVVLSEMKEAFHGL--------------QAFSAHGSGREVIDAMCHATLTYRMLE-VVNWEVIIMDEAHFLDPASIAARGWAAHRARATILMTATP.................... 137
6 -25.600d1gkub1 c.37.1.16 (B:6-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  18  38................................................................................................................EPRAIQKMWAKRILRKESFAATAPTGVGKT-SFGLAMSLFLALKGKRCYVIFPTSLLVIQAAETIRKYAEKAGVGIGYYHGRIPKREKENFMQKIVITTTQFLSKHYRE-LGHFDFIFVDDVDAI-HYDLKTKSWVGEARGCLMVSTATAKKG................. 212
7 -25.100d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors follow..  14  7..............................................................................................................................SFQVAHLHAPTGSGKST-----VPAAYAAQGYKVLVLNPSVAATLGFGAYMSK-------AHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIQAETAGARLVVLATATP.................... 136
8 -23.500d2pl3a1 c.37.1.0 (A:47-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  45................................................................................................................LVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFLVPVLEALYRLQLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGGKDLKHEAERINNILVCTPGRLLQHMDE-ATDLQMLVLDEADRI-ADTMNAVIENLPKKRQTLLFSATQTKS................. 213
9 -23.300d3bera_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  20..............................................................GVTDVLCEACDQLGWT----------------------------------KPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDSMSQSLALAKIIIATPGRLIDHLEN-LRALKYLVMDEADRI-ETEVDKILKVIPRDRKTFLFSATMTKK................. 201
10 -22.500d2z0ma1 c.37.1.0 (A:1-192) automated matches {Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  18  16................................................................................................................NFTEVQSKTIPLMLQGKNVVVRAKTGSGKTAAYAI-----ILELGMKSLVVTPTRELTRQVASHIRDIGRYMDTKVAEVYGGMPYKAQINRVRDIVVATPGRLLDLWSK-LSSFEIVIIDEADLM--DDIKIILAQTSNRKITGLFSATIPEE................. 173
11 -22.500d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  17  32................................................................................................................EPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRISVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLRQIVVGTPGRVFDNIQR-TDKIKMFILDEADEMLSEQIYQIFTLLPPTTQVVLLSATMPND................. 195
12 -22.500d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  19  81..............................................................................................................PFKLTNAQKRAHQEIRND-NRLLQGDVGSGKTVVAQLAILDNYEA-GFQTAFMVPTSILAIQHYRRTVESFSKFNIHVALLIGATTPSEKEKIKSDVVIGTHALIQEDVH--FKNLGLVIIDEQHRF-GVKQREALMNKGKMVDTLVMSATP.................... 241
13 -22.300d2oxca_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  23................................................................................................................RPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLENLSTQILILAPTREIAVQIHSVITAIGIMEGLECHVFIGGTPLSQDKTRLKHIAVGSPGRIKQLIEL-PGSIRLFILDEADKLLEEQINWIYSSLPASKQMLAVSATYPEF................. 188
14 -22.000d3dkpa1 c.37.1.0 (A:139-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  49................................................................................................................MPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQPANKALIISPTRELASQIHRELIKISEGTGFRIHMIHKAAVAAKKSSKKFDILVTTPNRLIYLLKQ-LASVEWLVVDESDKL-RDQLASIFLACTSHKVRRAMSATFAYD................. 221
15 -21.800d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  6..........................................................................................................PYNIKANLRPYQIKGFSWMRFMNKICLADDMGLGKTLQTIAVFSDAKKENELTPSLVICPLSVLKNWEEELSKFA--PHLRFAVFHED--RSKIKLEDYDIILTTYAVLLRDTRLKEVEWKYIVIDEAQNIKNPQTKIFAVKELKSKYRIALTGTPIENK................ 166
16 -21.600d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  23................................................................................................................HPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLVTGQVSVLVMCHTRELAFQISKEYERFSKMPNVKVAVFFGGLSIKKDEEVLKKIVVGTPGRILALARN-LKHIKHFILDECDKMLERDVQEIFRMTPHEKQVMMFSATLSKE................. 190
17 -21.300d4ct4b1 c.37.1.0 (B:95-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  24................................................................................................................KPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLKKDNIQAMVIVPTRELALQVSQICIQVSKMGGAKVMATTGGTNDIMRLDDTVHVVIATPGRILDLIKK-VDHVQMIVLDEADKLLSQIMEDIILTLPKNRQILLYSATFPLS................. 189
18 -21.200d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  17  23................................................................................................................KPTEIQERIIPGALRGESMVGQSQTGTGKTHAYLLPIMEKIERAEVQAVITAPTRELATQIYHETLKITKFCPKVARCLIGGTDALEKLNVQPHIVIGTPGRINDFIRE-VHTAHILVVDEADLM--TDVDQIAARMPKDLQMLVFSATIPEK................. 191
19 -21.100d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebrafish (Danio rerio) [TaxId: 7955]}  ali model 3D-neighbors follow..  12  55................................................................................................................VLRPHQREGVKFLWDSYGCIMADEMGLGKTLQCITLIWTLLKQSPDKVIVVSPS-SLVRNWYNEVGKWLGGRVQPVAIDGGSKDEIDSKRIPTPILIISYETFRLHAEVLHKKVGLVICDEGHRLKSDNQTYLALNSMNAQRRVLISGTPIQNDLLE---YFSLVHFVNS 247
20 -20.800d3iuya1 c.37.1.0 (A:213-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  41................................................................................................................KPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPISMLVLTPTRELALHVEAECSKYSYKGLKSICIYGGRNGQIEDISKGVDIIIATPGRLNDLQMN-LRSITYLVIDEADKM-EPQIRKILLDVRPDRQTVMTSATWPDT................. 210
21 -20.100d3mwja_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}  ali model 3D-neighbors follow..  17  7..............................................................PLKPEILEALHGRGLT----------------------------------TPTPIEAAALPLALEGKDLIGQARTGTGKTLAFALPIAERLAPSQERALVLTPTRELALQVASELTAVA--PHLKVVAVYGGTGYGKQKEALLDAVVATPGRALDYLRQ-LSRVEVAVLDEADEM--EEVEALLSATPPSRQTLLFSATLPSW................. 188
22 -20.000d3peya1 c.37.1.0 (A:91-286) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  18  24................................................................................................................KPSKIQERALPLLLHNRNMIAQSQSGTGKTAAFSLTMLTRVEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNK-QINAQVIVGTPGTVLDLMRR-LQKIKIFVLDEADNM-GDQCIRVKRFLPKDTQLVLFSATFADA................. 187
23 -19.900d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  25................................................................................................................QFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPAL-----LNGLTVVVSPLISLMKDQVDQLQAN----GVAAACLNSTQTREQQLEVMTGCRTGQIRLLYIAPERLMLDPVLLAVDEAHCISQPEYAALLRQRFPTLPFMALTATADDT................. 187
24 -19.700d2i4ia3 c.37.1.0 (A:168-406) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  35................................................................................................................RPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGP-SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERLLVATPGRLVDMMER-LDFCKYLVLDEADRMLDMGFEPQIRRIVEQRHTMMFSATFPKE................. 221
25 -19.100d5gvra_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  35................................................................................................................HPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRGLIICPSRELARQTHGILEYYCSSPLLRCALCIGGMSVKEQMETIRHMMVATPGRLMDLLQK-LDICRYLALDEADRM-EGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKVTINVGRA... 233
26 -18.700d5y4za1 c.37.1.14 (A:178-481) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}  ali model 3D-neighbors follow..  10  9..............................................................................................................................KKQLTVLDLHPGAGKTRRVLPEIVREAIKKRLRTVILAPTRVVAAEMEEALRG----------VRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQ-VPNYNLNIMDEAHFTDPSSIAAR-RVEMGEAAAIFMTATPPGTR................ 146
27 -18.200d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  19  48.........................................................................................................FCDSFPFETTPDQAQAINAVLSDMCQLVCGDVGFGKTEVAMRAAFLAVDN-HKQVAVLVPTTLLAQQHYDNFRDRFANWPVRIEMISRFRSAKEQTQILADILIGTHKLLQSDVK--FKDLGLLIVDEEHRF-GVRHKERIKAMRANVDILTLTATP.................... 213
28 -17.600d2gk6a1 c.37.1.19 (A:295-324,A:416-702) Upf1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  86................................................................................................................DLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQT----GLKVVRLCAKSREARELLMNADVICCTCVGAGDPRLA--MQFRSILIDESTQATEPECMVPVVLGAKQLILVGLGPVVMCKKAAKAGLSQSL...... 300
29 -15.300d4pj3a3 c.37.1.19 (A:416-492,A:662-1133) Pre-mRNA splicing factor Cwf11 / Aquarius {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  212..........................................................................................................PKRNTIQFTHTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQIISNIYHNFEQRTLIVTHSNQALNQLFEKIMA-LDIDERHLLRLGHGEEELETEKKEAKIIAMTCTHAALKRHDLVKKYDNILMEEA------------AQILEIETFIPLLLQNPQDGFSRLKRWIMIGD-LPP 519
30 -14.800d3jb9x3 c.37.1.19 (X:385-460,X:619-1044) Pre-mRNA splicing factor Cwf11 / Aquarius {Schizosaccharomyces pombe 972h- [TaxId: 284812]}  ali model 3D-neighbors follow..  184...............................................................................................................YTYNDKQLESILRGSQPGLTMVNGPTRCGKHVLVCKLLEVLQDTSNDRTVVLSDSNFSMNTLFTLLEKARCFHQGHLLYLSDEGKDETLERQQSRIIGCTWTSLSTRLGTLKECFNNLIVMNS------------QNISESSITSILLSNCEPTGFDRLVL---LGN-TSG 475
31 -12.900d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  11  77...............................................................................................................TGMFPFKVQLMGGVALHDGNIAEMKTGEGKTLTST-LPVYLNALTGKGVHVVTVNEYLASRDAEQMGKIFEFLGLTVGLNLNSMSKDEKREAAADITYSTNNELLYKEQMVQRPLHFAVIDEVDSIMTLATITFQNYFRMYEKLAGMTGTAKTEEEEFRNIYN-MQVVTIP 272
32 -12.700d3kx2a1 c.37.1.19 (A:1-270) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 559292]}  ali model 3D-neighbors follow..  50....................................................................FKGLQRHHTSAEEAQKLEDGKINPFTGREFTPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQV-VAAMSVAQRVAEEMDVKLG------EEVGYSIRFENKTSNKTILKYMTDGMLLREADHDLSRYSCIILDEAHELATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAPLLA. 266
33 -11.700d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  11  151...................................................................................................................NWQKVAAAVALTRRISVISGGPGTGKTTTVAKLLAALIQGERCRIRLAAPTGKAAARLTESLGK--ALRQLPLTDEQKKRIPEDASTLHRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIFL-----GDRDQLASVEA--GAVLG. 310
34 -10.200d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  10  22........................................................................................................................VLPNMVAGTVGALVSPGGAGKSMLALQLAAQIAGLPTGPVIYLP-----AEDPPTAIHH-------RLHALGAHLSAEERQAVADGLLIQPLPEWFDGLKRAAEGRRLMVLDTLRRFHIGRMEAIAADTGCSIVFLHHASKGAAMMGAGDQQQASRGS.... 198
35 -9.720d3l0ob2 c.37.1.0 (B:137-420) automated matches {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  16  31.......................................................................................................................DLFAPIGKGQRGMIVAPPKAGKTTILKEIANGIAENHPDTIRIIL----LIDERPEEVTDIRESTNAIV-IAAPFDMPPDKQVKVAELTLEMAKRLVEFNYDV-----VILLDS------------LTRLARVYNIVVPPSGKLLTGGVDPAALYKPKRFFG. 170
36 -9.680d2vhja_ c.37.1.11 (A:) automated matches {Pseudomonas phage [TaxId: 161736]}  ali model 3D-neighbors follow..  65.....................................................................RIVAYKEKSVKAEDGSVSVVQVENGFMKQGHRGWLVDLTGELVGCSPVVAEFGGHRYASGMVIVTGKGNSGKTPLVHALGEALGGKDK---YATVRFGEPLSGYNTD------------------------------------NVFVDDIARAMLQHRVIVIDSLKNVIGRGAFDLLSDIGAMAASRGCVIASLNPTSNDDKIVELVKE.... 248
37 -9.460d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  16..................................................................................................................NEELTNFLKSLSDQPRDLLYGPNGTGKKTRCMALLESIFGPGVYRLKIDVRQFVTASNRKLELNVVSSPYHLEITPSMGNNDRIVIQELLKEVAQMEQVDFQDSKDGLAHRYKCVIINEANSLTKDAQAALTMEKYSKNIRLIMVCDSMSP................. 173
38 -9.390d4lcba_ c.37.1.0 (A:) automated matches {Acidianus hospitalis [TaxId: 933801]}  ali model 3D-neighbors follow..  13  40...................................................................................................................................LLYGPPGNGKTMLAAAVANEI-----DSYFIHVDAASIMSKWLGEAEKN----------------------------VAKIFNTAREYSKKDNKPAIIFVDEIDALLGTY-EVGGEVRVRNQFLKEMDGIMDKNENYMVYV---IGATNKP 155
39 -9.330d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus elongatus PCC 7942 [TaxId: 1140]}  ali model 3D-neighbors follow..  17.......................................................................................................................DISHGGLPIGRSTLVSTSGTGKTLFSIQFLYNGIIEFDEPGVFVT-----FEETPQDIIKNARVDEGKLFILDASPDPEGQEVVGGFDLSALIERINYAIQKY--RARRVSIDSVTSVASSVVRRELFRLVARLKQIGATT...................... 165
40 -9.270d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Pyrobaculum aerophilum [TaxId: 13773]}  ali model 3D-neighbors follow..  10  21..................................................................................................................REQQLQQLDILLGNPRATLLGRPGTGKTVTLRKLWELYKDKTTARFVYI-NFTAIIGEIARSL----------------NIPFPRRGLSRDEFLALLVEHLRER-----DLYMFLVLDDAFNLAPDILSTFIRLGQEADKLVIVGHNDAVLNNLDPSTRGIMGK.... 184

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.