current user: public

If you have questions about the server, please let us know.

Query: d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst SQRVLVEPDAGAGVAVMKFKNPPVNSLSLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLDLTEMCGRSPAHYAGYWKAVQELWLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYCIGLNETQLGIIAPFWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTALSAIAQWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFISKDSIQKSLQMLast
1 -98.200d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]}  ali model 3D-neighbors  100  1SQRVLVEPDAGAGVAVMKFKNPPVNSLSLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLDLTEMCGRSPAHYAGYWKAVQELWLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYCIGLNETQLGIIAPFWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTALSAIAQWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFISKDSIQKSLQM 249
2 -84.500d2ppya_ c.14.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}  ali model 3D-neighbors follow..  22  5TKKQYLTVFKEDGIAEIHLHINKSNSYDLEFYKEFNAAIDDIRFDPDIKVVIVMSDVPKFFSAGADINFLRSADPRFKTQFCLFCNETLDKIARSPQVYIACLEGHTVGGGLEMALACDLRFMGDEA-GKIGLPEVSLGVLAGTGGTQRLARLIGYSRALDMNITGETITPQEALEIGLVNRVFPQAETRERTREYARKLANSATYAVSNIKLAIMNGKEMPLNVAIRYEGELQNLLFRSEDAKEGLS. 251
3 -83.500d5jbxa_ c.14.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 246197]}  ali model 3D-neighbors follow..  22  1..MPEFKVDARGPIEIWTIDGESRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGDKAFCAGADLKERATMAEDEVRAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAAPAAEL--GLTEVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLAPEGHLLAVAYGLAESVVENAPIAVATAKHAIDEGTGLELDDALALELRKYEEILKTEDRLEGLR. 245
4 -82.400d3peaa_ c.14.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}  ali model 3D-neighbors follow..  20  2..LKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEG-RFFSAGADIKEFTSVTEAKATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMRFATESAKL--GLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGVFAEETFLDDTLKVAKQIAGKSPATARAVLELLQTTKSSHYYEGVQREAQIFGEVFTSEDGREGVA. 245
5 -81.400d4jwva1 c.14.1.0 (A:3-257) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  19  1...ADIDFRIEGHVAHVRLNRPQGNAITQEMDDLLLDAWTEVNANSDIWAVVLSAEGEKAFCIGADVSGGAERKTRM--ALGGGLTGIGGPLVTCKKPMVAAVQGFCVGGGFELAMCADIIVAADTAQF--GLPETKVGIIGECGVVHRAMRQLPYHIALQLILTGERIKADEARHYGLVNEVVPFAELEEAALRWASKLNAASPLAVQAAKAAALGRLGHPLEVALMTRFEPIEEYAATEDKKEGER. 242
6 -79.700d4kd6a_ c.14.1.0 (A:) automated matches {Burkholderia graminis [TaxId: 396598]}  ali model 3D-neighbors follow..  24  2.....VLFSNHGRVAVITLNRPELNAWTTPMRETIIDALERFNRDPEVAAIIMTGAGNRAFSAGQDLSEAHDFDGERAVAWVKEWQRYYTALRSLSKPLVMALNGTAAGSAFQVALLGDIRVGHPGVRM--GQPEINAGI-ASTTGPWIMNAMLGMSRTIELTLTGRLMEAEECHRIGLIHHLVDEDKVFDKALEIATELAAKPPVAMRLDKQRFREMTEPGFIDCIEAGER................. 226
7 -79.600d3moya_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  22  1TTYTTIATSRVAGVGLIRLDRPDLNALNQTLEAEVLDAARDFDADLEIGAIVVTGSE-RAFAAGADIAEMVTLTPHQARE--RNLLSGWDSLTQVRKPIVAAVAGYALGGGCELAMLCDLVIAADTARF--GQPEITLGILPGLGGTQRLTRAVGKAKAMDLCLTGRSLTAEEAERVGLVSRIVPAADLLDEALAVAQRIARMSRPAGRAVKDAINEAFERPLSAGMRYERDAFYAMFDTHDQTEGMT. 245
8 -79.200d3swxa_ c.14.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 36809]}  ali model 3D-neighbors follow..  20  1.DYETLRIRRDGYVLVIGLNRPAKNAFDKTMLEELALALGEYETDTDLRAAVLYGEG-PLFTAGLDLASVAAEIQGGASLTPEGINPWQVDGRQLSKPLLVAVHGKVLTLGIELALAADIVIADETATF--AQLEVNRGIYPFGGATIRFPRTAGWGNAMRWMLTADTFDAVEAHRIGIVQEIVPVGEHVDTAIAIAQTIARQAPLGVQATLRNARLAVREGDAAAEEQLVPTVRELFTSEDATLGVQ. 246
9 -78.800d5c9ga1 c.14.1.0 (A:2-260) automated matches {Hyphomonas neptunium [TaxId: 228405]}  ali model 3D-neighbors follow..  19  2...LPIRLDIAAPLAEIVLNKPERNALSVDMWAAIPGLVAEANANPDVKLILIHGGDAGAFAAGADISEFETITEDAAKASGQRIAQALDAIENSEKPVIAAIEGACVGGGVSLAMAADLRVAGEGAKF--GVTPGKLGLVYPAGDTRRLLAAVGPGATKDILFTGRIFTAGEAKSLGLIDRLVEKGTALEAARVWAGEIAAISQWSVRATKRMIR-GLQTGWTDETPEAQSLFLNGFANEDFKEGYR. 246
10 -78.300d4moua_ c.14.1.0 (A:) automated matches {Arthrobacter aurescens [TaxId: 290340]}  ali model 3D-neighbors follow..  19  4.RTGRISVAIADGVASVEISNLARNALTKDMCLEIQELMPQLDADPDVAVVVLRGAG-DTFCAGASISELASVDPQPDGSTADHLSRADSAIAALSKPAVALVDGACMGGGWQIASACDFIIANERAVI--GLTPAKIGIIYPRPGLERLVRLVGHANAKYILLTGQTFSAPEARALGLVADVVPSESFEEKCAALVRSLRSRSRFSMHSMKRLVDLTDSVPAAGIDQEWAAAWSAMPDSPDMGIGIS. 250
11 -78.300d4f47a_ c.14.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}  ali model 3D-neighbors follow..  22  2...PDALVEQRGHTLIVTMNRPSRNALSGEMMQIMVEAWDRVDNDPDIRCCILTGAG-GYFCAGMDLKAATKKPPGDSFKYDPSRIDALLKGRRLKKPLIAAVEGPAIAGGTEILQGTDIRVAAESAKF--GISEAKWSLYPMGGSAVRLVRQIPYTVACDLLLTGRHITAAEAKEMGLVGHVVPDGQALTKALEIAEIIAANGPLAVQAILRTIRETEGMHENEAFKIDTRIGIEVFLSDDAKEGPQ. 247
12 -78.000d3h0ua1 c.14.1.0 (A:8-283) automated matches {Streptomyces avermitilis [TaxId: 33903]}  ali model 3D-neighbors follow..  20  2ASYETIKARLDGTVLSATFNAPPMNLIGPEVVRDLVALLEELAHPTAPRVVIFDSADADFFFPHVDMTKVPEYTAEAAKAGDASLGMLFRKLSQLPAVTIAKLRGRARGAGSEFLLACDMRFASRE-NAILGQPEVGIGAPPGAGAIQHLTRLLGRGRALEAVLTSSDFDADLAERYGWVNRAVPDAELDEFVAGIAARMSGFPRDALIAAKSAIN-AISLPAPAEVRADAALFQQLVRGEKVQQRTA. 250
13 -77.900d4lk5a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 262316]}  ali model 3D-neighbors follow..  18  2APVAGLDVTLSDGVFSVTINRPDLNSLTVPVITGIADAMEYAATDPEVKVVRIGGAG-RGFSSGAGISADDVSDGVPPDEIILEINRLVRAIAALPHPVVAVVQGPAAGVGVSIALACDVVLASENAFF--MLAFTKIGLMPDGGASALVAAAVGRIRAMQMALLPERLPAAEALAWGLVTAVYPADEFEAEVDKVIARLLSGPAVAFAKTKLAINAATLTELDPALQREFDGQSVLLKSPDFVEGAT. 249
14 -77.700d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]}  ali model 3D-neighbors follow..  21  1....MVFEENSDEVRVITLDHPNHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNEVKQLSRSEIEEWIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANF--VMPELKHGIGCSVGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKRAVNKPFIHLLEQTRDASKAVH............... 229
15 -77.400d2j5ia_ c.14.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  22  4GRWKTVKVEIEDGIAFVILNRPEKNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAG-EAWTAGMDLKEYFREVDAGPKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATF--GLSEINWGIPPGNLVSKAMADTVGHRQSLMYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKHGFKRCRELTWEQNEDYLYAKLDQSRLLD........ 247
16 -77.100d4jyla1 c.14.1.0 (A:1-243) automated matches {Thermoplasma volcanium [TaxId: 273116]}  ali model 3D-neighbors follow..  23  1...MLVEIERRGDASLIVLSRPELNAINLEMLADLADQFSKAEKE-DTRVIVITGYG-KNFSAGADINMLASFDPASAYSFRLKMNSIAQRIRKSDKPVIALLKGYSMGGGLELAESADIRIAMSDAVI--GQPESSIGINAGAGGNVILPKLVGRGSAAYLAMSGKKLNAQEAMALGLVDEVVDDEA---KAWKIIDDICKKPKKTLQFIKRAINSSYDMGLESAMDQEALYFSLLFTDPEVLDALS. 239
17 -77.100d4qfea1 c.14.1.0 (A:2-229) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  20  2...EPVRIERNGPVTTVIIDRPEANAVNGPTAAALFAAFEEFDADDTASVAVLTGAN-GTFCAGADLKAFGTPEANQVHR--EGPGPMGPSRMDLSKPVIAAISGYAVAGGLELALWCDLRVVDEDATM--GVFCRRWGVPLIDGGTVRLPRLIGHSRAMDLILTGRAVDAAEAYAIGLANRVVPTGQARQAAEELAADLARLPQQCMRADRLSALHQWGESENAAMDFEFASI............... 228
18 -77.000d4jcsa1 c.14.1.0 (A:1-264) automated matches {Cupriavidus metallidurans [TaxId: 266264]}  ali model 3D-neighbors follow..  18  1..MDTLDFEVVNNVGWIRMNRAAHNPFDAELRADLMTVLERVRDDADIRVLVLTSHP-GSFCAGGNLHVLRDNGPAYWQQRIKTGLRFIHDMLNLGRPVIAAVDGPAFGAGFALSLTADIVLASPRARF--SMAYLRLGLVPDLGALYLLPRAVGLQRAKELMFSTRELDAEEAHRLGLVMEVHESEALEQRAREIAESLVQAAPTALALTKAALNVSLDSDEQTMFSLEAASQAAAFSTKEPRAAIE. 247
19 -76.900d3gowa_ c.14.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}  ali model 3D-neighbors follow..  26  1....MVLKERQDGVLVLTLNRPELNAITGELLDALYAALKEGEEDREVRALLLTGAG-RAFSAGQDLTEFGDRKP-DYEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASF--TTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVR. 241
20 -76.800d4jfca_ c.14.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}  ali model 3D-neighbors follow..  19  2....AIKSTSEGQTLILTLSNPERNALGPEIYAAGIEALNAAENNPEIRSVVITGEG-AVFCAGGNLQRLQANAPEVQAQSIEGLHNWIDSIRTYPKPVIAAVEGAAAGAGFSLALACDFVVAASNAVF--VMSYSTVGLSPDGGGSWSLARSLPRALASELLMGGERISAQRLHDLGLVNKVASAGDALSEALRMAGQLNARAPNALASIKELINEASSNTLSQQLACERDHFVRNLHHSNGGEGIA. 246
21 -76.800d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  2.SYQYVNVVTINKVAVIEFNYGRLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDIHELPSGGRDP-LSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTF--SMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFEQGMRRAVYDSEDYQEGMN. 248
22 -76.500d4k2na1 c.14.1.0 (A:1-259) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  18  2..SDVIQLVREGAIATVTLNRPDMNALNLPMWRGLAEAFETISADRSIHVVILRGAGTKAFAPGADIEEFDTLNAEQAKAYDLVMRKALDTVRACPQPVIAAIWGPCVGGGLELACCCDIRLSAKSGKF--GVPINKISVVMAYPELAQIRRVAGPAAALEILLEGRIMDADEAAAKRLVNRVVEDDAMDAEVAATAKRIAAGAPLANRWHKAFIARLDDPTPVSEA--ELDECYRFLDTKDYAEGLA. 246
23 -76.300d3myba_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  20  1.EPLLLQDRDERGVVTLTLNRPQANALSEAMLAALGEAFGTLAEDESVRAVVLAASG-KAFCAGHDLKEMRAEPSREYEKLFARCTDVMLAIQRLPAPVIARVHGIATAAGCQLVAMCDLAVATRDARF--AVSGINVGLFCSTPGVA-LSRNVGRKAAFEMLVTGEFVSADDAKGLGLVNRVVAPKALDDEIEAMVSKIVAKPRAAVAMGKALFYRQIETDIESAYADAGTTMACNMMDPSALEGVS. 245
24 -76.100d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]}  ali model 3D-neighbors follow..  21  2..YEAIGHRVEDGVAEITIKLPRRNALSVKAMQEVTDALNRAEEDDSVGAVMITGAE-DAFCAGFYLREIPLDKGVAFRIAALWWHQMIHKIIRVKRPVLAAINGVAAGGGLGISLASDMAICADSAKF--VCAWHTIGIGNDTATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKERFHAGWMQPVEECTEFEIQNVIASVTHPHFMPCLT. 250
25 -75.700d4wcza_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  23  1...MSLRLERDGAVARLLIDRADRNAFSLDMWQRLPELLAEASGDDALRVLVVKSANGGAFCAGADIAELLANDAAFHAANQQAINRAQYELARFRLPTVAMVEGDCIGGGCGIALACDMRIAAPAARF--GITPAKLGLVYPLHDVKLLVDLVGPGQARRLMFTGGLIDANEAHRIGLVELLGESEDAL------VGQLATVSSFSTQAIKSFVRRVLDGQVADDAD-SLRVFASAFEGADFREGTG. 239
26 -75.400d4og1a_ c.14.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}  ali model 3D-neighbors follow..  16  5NFHDRVSVTIEDHVAHVLLDRADMNALDDAMFEGIVAAGHHLHSVKGVRCVVLSGAG-RSFCAGLDLSSMGRTDRERTHGNANRAQQAAMVWRKLPMPVIAAVHGVCFGGGLQVASGADIRFITPDARL--AVMEVKWGLVPDMAGYALWRGNVRDDVLRELTYTHREFSGEEAVRFGFATHVAD--DPLAGAMELARVVAEKSPNAVRGAKTLSNRAPDLTVDDVLMAESIAQHELMYSRNQMEAVK. 255
27 -74.800d3rrva_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  17  2DMPTEIDVRADGALRIITLNRPDLNSVNDDLHVGLARLWQRLTDDPTARAAVITGAG-RAFSAGGDFGYLKELSADADAKTIRDGREIVLGMARCRIPVVAAVNGPAVGLGCSLVALSDIVYIAENAYL--ADPHVQVGLVAADGGPLTWPLHISLLLAKEYALTGTRISAQRAVELGLANHVAD--DPVAEAIACAKKILELPQQAVESTKRVLNIHLERAVLASLDYALSAESQSFVTEDFRSIVT. 247
28 -74.800d3tlfa_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}  ali model 3D-neighbors follow..  16  1DSFDTIKYEVDGHTATITLNRPDLNALSPHMITELRAAYHEAENDDRVWLLVVTGTG-RAFCSGADVKEIPEDGKVIYERQWEAPQEGTPPFRTMAKPVLTAVNGICCGAGMDWVTTTDIVIASEQATF--FDPHVSIGLVAG-RELVRVSRVLPRSIALRMALMGKRMSAQRAYELGLISEIVEHDRLLERAHEIADIVNSNAPLAVRGTRLAILKGLNVPLHEAEILAETFRERVLRTEDAAEGPR. 254
29 -74.700d4neka_ c.14.1.0 (A:) automated matches {Magnetospirillum magneticum [TaxId: 342108]}  ali model 3D-neighbors follow..  23  2...ELVLSHVEGGVQVVRMNRPDKNALIGEMYAALAEAFAKGEADDDVNVFLILGSQ-TDFSAGNDLPDFLTWEALSGSVA----DRFIRAVAGARKPVVAAVRGAAIGIGSTLLPHCDLVYAAPGTRF--HMPFINLGIVPEAGSSQTMPALAGHRRAAEMLMLGEPFGVDTAEAVGLINGVVPGEDLEETAMAAARKLAAKPRSILVQIKALMKTPAE-PIMDRLTREAAVFDTCLKGEALNEAVS. 239
30 -74.500d2q35a1 c.14.1.0 (A:17-257) automated matches {Lyngbya majuscula [TaxId: 276768]}  ali model 3D-neighbors follow..  17  1...VVQLTELGNGVVQITMKDESRNGFSPSIVEGLRHCFSVVAQNQQYKVVILTGYG-NYFSSGASKEFLIRKTRGEVE-----VLDLSGLILDCEIPIIAAMQGHSFGGGLLLGLYADFVVFSQESVY--ATNFMKYGFTPVGATSLILREKLGSELAQEMIYTGENYRGKELAERGIPFPVVSRQDVLNYAQQLGQKIAKSPRLSLVALKQHLSADIKAKFPEAIKKELEIHQVTFNQPEIASRIQ. 238
31 -74.400d3pe8a_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  22  2...PVLLVDTTDRVRTLTLNRPQSNALSAELRSTFFRALSDAQNDDDVDVVIVTGAD-PVFCAGLDLKELGDTTELP---------DISPKWPDMTKPVIGAINGAAVTGGLELALYCDILIASENAKF--ADTHARVGLMPTWGLSVRLPQKVGVGLARRMSLTGDYLSAQDALRAGLVTEVVAHDDLLTAARRVAASIVGNNQKAVRALLDSYHRIDALQTGGALWAEAEAARQWMRST........ 228
32 -73.800d4qiia_ c.14.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  16  21.TDITYHRHVDDATVRVAFNRPEVNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPWAFCSGGDQRIRGRSGYQYARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASRE-YARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLL-DDGLVGQQLFAGEATRLAYMTDEAVEGRD. 283
33 -73.500d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  20  6ARYPGLAFAWRPGVLEITFRGEKLNAMPPALHRGLARVWRDLEAVEGVRAVLLRGEG-GVFSAGGSFGLIEEMSHEALLRVFWEARDLVLGPLNFPRPVVAAVEKVAVGAGLALALAADIAVVGKGTRL--LDGHLRLGVAAGDHAVLLWPLLVGMAKAKYHLLLNEPLTGEEAERLGLVALAVEDEKVYEKALEVAERLAQGPKEALHHTKHALNHWYRSFL-PHFELSLALEFLGFSGKELEEGLK. 252
34 -73.300d3qxza1 c.14.1.0 (A:3-260) automated matches {Mycobacterium abscessus [TaxId: 561007]}  ali model 3D-neighbors follow..  19  1...TELHEEIRDGVAVLTLHGPSRNSFTVELGRQLGAAYQRLDDDPAVRVIVLTGAP-PAFCSGAQISAAAETFAAP-RNPDFSASPVQPAAFELRTPVIAAVNGHAIGIGMTLALHADIRILAEEGRY--AIPQVRFGVAPDALAHWTLPRLVGTAVAAELLLTGASFSAQRAVETGLANRCLPAGKVLGAALRMAHDIATNAPESAALTKRLLWDAQMTGMSEVAARETADHLRLMGSQDAAEGPR. 245
35 -73.200d3i47a1 c.14.1.0 (A:4-260) automated matches {Legionella pneumophila [TaxId: 272624]}  ali model 3D-neighbors follow..  21  1...SDLLYEIQDKVGLLTMNRISKNAFDNQLLTEMRIRLDSAINDTNVRVIVLKANG-KHFSAGADLTWMQSMTEEENLEDSLVLGNLMYSISQSPKPTIAMVQGAAFGGGAGLAAACDIAIASTSARF--CFSEVKLGLIPA-VISPYVVRAIGERAAKMLFMSAEVFDATRAYSLNLVQHCVPDDTLLEFTLKYASQISNNAPEAVKNSKQLAQYVANKKIDEELRYTASLIAHKRVSDEGQEGLK. 246
36 -72.800d3fdua1 c.14.1.0 (A:10-255) automated matches {Acinetobacter baumannii [TaxId: 400667]}  ali model 3D-neighbors follow..  19  1..HPHLNANLEGGVLTLAINRPEKNALYGELYLWIAKALDEADQNKDVRVVVLRGAE-HDFTAGNDMKDFMGFNPNAGPAGQVPPFVLLKSAARLSKPLIIAVKGVAIGIGVTILLQADLVFADNTALF--QIPFVSLGLSPEGGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEIVE--DAYATAQATAQHLTALPLASLKQTKALMKHDLD-QIIECIDHEAEIFMQRVQSPEMLEAVQ. 243
37 -72.300d5e0nx_ c.14.1.0 (X:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  25  1.TRFVLLDRSRPGVALVTLNRPEMNSMAFDVMVPLLELLGDLRHDNSVRVVILTGAG-RGFSSGADHKSAGSVPPTYALRSMEVLDNVILALRRLHQPVIAAVNGAAIGGGLCLALACDVRIAAHNAYF--RAAGINNGLTASLGLSYLLPRAIGTSRAFEIMLTGRDVDAAEAERIGLVSRTVPDDDLLETCFEMAQRMRGFSRPGIELTKRTLWSGLDASLEGHMQAE................... 236
38 -72.100d4k29a_ c.14.1.0 (A:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}  ali model 3D-neighbors follow..  21  1.TYSKILYETLHGVARITLNRPETNALDQEMLGEINAAMDAAEADAGVKAVIVRGAG-NAFSSGFDLKAQMEARPAGVRPLLRKDFDTVMRFWHCPKPTIAAVRGPCLAGACELALACDMTIATEDAFF--GEPELKFG---AGIVVMLLPWIVGPKIAKEIILLGERVPARRAAEIGMVNRVVDGDGLDAEALRIARHIGAIDPGLVKETKRALNRALETEIDLAIEGAGSPDKIAFFEVARRDGLR. 257
39 -71.800d5dufa1 c.14.1.0 (A:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  22  1....MIGITQAEAVLTIELQRPERNALNSQLVEELTQAIRKAG-DGSARAIVLTGQG-TAFCAGADLSGD-----AFAADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFF--QFPTSKYGLALDNWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIGTLAD----AQAWAAEIARLAPLAIQHAKRVLNDDG--AIEEAWPAHKELFDKAWGSQDVIEAQV. 230
40 -71.800d3oc7a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 243243]}  ali model 3D-neighbors follow..  19  5.VDYAGPAATGGPVARLTLNSPHNNALSTALVSQLHQGLRDASSDPAVRVVVLAHTG-GTFCAGADLSEAGSGGSDMAVERAREMAALMRAIVESRLPVIAAIDGHVRAGGFGLVGACDIAVAGPRSSF--ALTEARIGVAPAIISLTLLPK-LSARAAARYYLTGEKFDARRAEEIGLITMAAE--DLDAAIDQLVTDVGRGSPQGLAASKALTTAAVLERFDRDAERLAEESARLFVSDEAREGML. 251
41 -71.800d4k3wa_ c.14.1.0 (A:) automated matches {Marinobacter aquaeolei [TaxId: 351348]}  ali model 3D-neighbors follow..  25  1..CETLILEKQGPTLVITINRPDVNAMSLQMVAELSTIFSEIENDISIRAAVLRGAG-GHFCAGGDIKDMAGARSQKAGELNRAFGQMIQQVNESSKVVIAITEGAVMGGGFGLACVSDLAIAGPTAKF--GMPETTLGVIPAQIAPFVVER-IGLTQARRLALLGLRIDATEACKLGIVHQVAESEEQLSDMLQALERVRLCAPDATAETKALLHRVGHEAMAGLLDDAAEKFAAAIRGPEGAEGTM. 252
42 -71.500d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  20  4...SIQVTSAQKHVLHVQLNRPERNAMNRAFWRELVECFQKISKDSDCRAVVVSGAG-KMFTSGIDLMDMASDILQPLRDLISRYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFF--QVKEVDVGLAADVGTLQRLPKVIGRSLVNELTFTARKMMADEALDSGLVSRVFPDDVMLNAAFALAADISSKSPVAVQGSKINLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQ. 259
43 -71.500d4izba_ c.14.1.0 (A:) automated matches {Ruegeria pomeroyi [TaxId: 246200]}  ali model 3D-neighbors follow..  18  4SGYSNLDLDRDNGVCVVTLNRPDRNALDVATIEELVTFFSTAH-RKGVRAVVLTGAG-DHFCAGLDLVEHWKASADDFMHVCLRWHEAFNKMEYGGVPIIAALRGAVVGGGLELASAAHLRVMDQSTYF--ALPEGQRGIFTGGGATIRVSDMIGKYRMIDMILTGRVYQGQEAADLGLAQYITEGSSF-DKAMELADKIASNLPLTNFAICSAISHMQNMSGLDAAYAEAFVGGIVNTQPAA...... 245
44 -71.000d4jota1 c.14.1.0 (A:1-253) automated matches {Deinococcus radiodurans [TaxId: 243230]}  ali model 3D-neighbors follow..  21  9TQRPLSQDGTTQGGTVATLTLAAMGSMGPAFWQEFPQALSE---LGDARVLIVRGE--QVFSAGLDVKSNGAAKPDAFKAVVDEMHAVTEGLAALPMPVIAAVHGWCIGAGLELIAGADLRLCSQDARF--SLPEVKLGITADLGGLQRLPHLIGRGRTAHLALTGEAIDAATAERWGLVTEVLPDDALFARAEALAEHLAALPAKALEGTKRALSDGL--PHAESLAAAVRWNAEHMTVEALQAG... 253
45 -70.500d2gtra_ c.14.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1.RYRDIVVRKQDGFTHILLSTKSNNSLNPEVMREVQSALSTAAAD-DSKLVLLSAVG-SVFCCGLDFIYFIRRLTDDSTKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWF--QTPYTTFGQSPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMKMELEQANERECEVLKKIWGSAQGMDSML. 249
46 -69.200d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  2..FETLVVTSEDGITKIMFNRPKKNAINTEMYHEIMRALKAASKDDSII-TVLTGNG-DYYSSGNDLTNFTDIPPGGAKNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATF--HTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKEVIRKREREKLHAVNAEECNVLQGRWLSDECTN.... 245
47 -67.900d3hp0a_ c.14.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  18  1.TYQTIKVRFQASVCYITFHRPEANTINDTLIEECLQVLNQCE-TSTVTVVVLEGLP-EVFCFGADFQEIYQEMKRKQASSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASF--SLSELLFGLYPA-CVLPFLIRRIGRQKAHYMTLMTKPISVQEASEWGLIDAFDAESDVL--LRKHLLRLRRLNKKGIAHYKQFMS-SLDHQVSRAKATALTANQDMFSDPQNQMGII. 242
48 -67.300d2j5ga_ c.14.1.0 (A:) automated matches {Nostoc sp. PCC 7120 [TaxId: 103690]}  ali model 3D-neighbors follow..  13  6TKYENLHFHRENGILEVRMHTNGSLVFTGKTHREFPDAFYDISRDRDNRVVILTGSG-DAWMAEIDFPSLGDVNPREWDKTYWEGKKVLQNLLDIEVPVISAVNGAALLHS-EYILTTDIILASENTVFQ-DMPHLNAGIVPGDGVHILWPLALGLYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPTLNLRYTRVALTQRLKRLVNEGIGYGLALEGITATDLR....... 247
49 -64.300d1hnua_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  13  2...EKISYRIEGPFFIIHLINPDLNALEGEDYIYLGELLELADRNRDVYFTIIQSSG-RFFSSGADFKGIAKAQGDDVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSIND-KVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLKRFR. 262
50 -64.100d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]}  ali model 3D-neighbors follow..  25  12........ALESGIVELKFDLKSVNKFNRLTLNELRQAVDAIKADASVKGVIVSSGK-DVFIVGADITEFVELPDAELIAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLEMCLAADFRVMADSAK--IGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVSAVDAVVTADKLGAAALDLIKRAISGELDAPVEAIKTIQKAANFGRDKALEVEAAGFAKLAKTSASNCLIGL 293
51 -11.000d2f6ia1 c.14.1.1 (A:179-366) Clp protease, ClpP subunit {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}  ali model 3D-neighbors follow..  15  23........................DEINKKTADELISQLLYLDNINHNDIKIYINSPGGSINEGLAI---------------------LDIFNYIKSDIQTISFGLVASMASVILASGK-RKSLPNCRIMIHQPDIEIQTKEILYLKKLLYHYLSSFTIEKDSDRDYYMNALEAKQYGIIDEVIETKLPHPY......................................................... 186
52 -10.500d3gf3a1 c.14.1.4 (A:3-291) Glutaconyl-CoA decarboxylase A subunit {Clostridium symbiosum [TaxId: 1512]}  ali model 3D-neighbors follow..  11  106.............VYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLN------CSGVEFPN--QDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGILSGMN-----PKGYIDDEAAEQIIAAQIENSKLKVPAYDETGFFREVYQNDL---GVIDGIKKYISYLP............................................ 288
53 -10.500d1yg6a_ c.14.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  33........................GQVEDHMANLIVAQMLFLEAENPEKDIYL------INSPGGVITA---------------GMSIYDTMQFIKPDVSTICMGQAASMGAFLLTA-GKRFCLPNSRVMIHQPDIEIHAREILKVKGRMNELMALHQIERDTERDRFLSAPEAVEYGLVDSILTHRN............................................................. 193
54 -10.400d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]}  ali model 3D-neighbors follow..  12  91.............VHAASQDFTVMGGSAGETQSTKVVETMEQALLTGTPFLFFYDS------GGARIQEGIDSLSGYGKMFFANVK------LSGVVPQIAIIAGPCAGGASYSPALTDFIIMTKKAHMFITGPQV-------------IKSVTGEDVTADEL------AEAHMAISGNIHFVAEDDD---AAELIAKKLLS............................................... 247
55 -10.100d4gm2a_ c.14.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}  ali model 3D-neighbors follow..  11  14........................SPIYPHISEQIISQLLYLEYESKRKPIHLYINSTGD----------IDNNKIINLNGITDVISIVDVINYISSDVYTYCLGKAYGIACILASSGK-RFSLKNSSFCLNQSNIEIQNKEIMNTKKKVIEIISKNVISNVLERDKYFNADEAVDFKLIDHILEK............................................................... 183
56 -9.890d2f9ia1 c.14.1.0 (A:1-314) automated matches {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  11  102...........NGRAVTVIGQQRGKDTKDNIYRN-FGMAHPEGYRKALRLMKQAEKFNRPIFTFIDTKGAYPGKAAEERGQSESIATNLIEMASLKVPVIAIVIGEGGSGGALGIGIANKVLMLENSTYSVISPEGAAALLWKDSNLAKIAAETMKITAHDIKQLGII-VISEPLGGAHKDIEQQALAIKSAFVAQLDSLESLSRDEIANDR..................................... 302
57 -9.310d3tdca1 c.14.1.0 (A:1719-2042) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  232................................................................................................IVTISLVTCRAIGIGAYLVRLGQRVIQVENSHIILT-------------GASALNKVLGREVYTSNNQLG---GVQIMHYNGVSHITVPDDF---EGVYTILEWLSYMP............................................ 321
58 -9.160d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  11  98.............VVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASG------GARMQE-----ALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVASFAMLGDLNIAEPKALIGFAGPRV-------------IEQTVREKLPPGF-------RSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPA............................................ 260

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.