current user: public

If you have questions about the server, please let us know.

Query: d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst SGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVLast
1 -106.000d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1SGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV 207
2 -98.300d4ct4b1 c.37.1.0 (B:95-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  34  2NEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTV-HVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLS-QDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINL 206
3 -97.400d2oxca_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  36  1ADFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLKK--CHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMRDPTFVRL 205
4 -94.500d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  32  1TQFTRFPFQPFIIEAIKTLRFYKPTEIQERIIPGALRGESMVGQSQTGTGKTHAYLLPIMEKIKPERAEVQAVITAPTRELATQIYHETLKITKFCPMIVARCLIGGTDKQKALEKLNVQ-PHIVIGTPGRINDFIREQALDVHTAHILVVDEADLMLD-MGFITDVDQIAARMPKDLQMLVFSATIPEKLKPFLKKYMENPTFVHV 208
5 -94.200d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  39  10YKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHM-DIKVHACIGGTSFVEDAEGLRD--AQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLS-SGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILV 212
6 -91.000d3peya1 c.37.1.0 (A:91-286) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  30  2KSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINA------QVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIV........ 196
7 -90.600d3bera_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  33  14KTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSI-GVQSAVIVGGIDSMSQSLALAKK-PHIIIATPGRLIDHLENKGFNLRALKYLVMDEADRILN-MDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAV 218
8 -90.000d3mwja_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}  ali model 3D-neighbors follow..  34  2.EFKDFPLKPEILEALHGRGLTTPTPIEAAALPLALEGKDLIGQARTGTGKTLAFALPIAERLAPSQRKPRALVLTPTRELALQVASELTAVAPH---LKVVAVYGGTGYGKQKEALLRGA-DAVVATPGRALDYLRQGVLDLSRVEVAVLDEADEMLS-MGFEEEVEALLSATPPSRQTLLFSATLPSWAKRLAERYMKNPVLINV 205
9 -89.500d2z0ma1 c.37.1.0 (A:1-192) automated matches {Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  34  1.......MNEKIEQAIREMGFKNFTEVQSKTIPLMLQGKNVVVRAKTGSGKTAAYAIPILEL------GMKSLVVTPTRELTRQVASHIRDIGRYM-DTKVAEVYGGMPYKAQINRVRN--ADIVVATPGRLLDLWSKGVIDLSSFEIVIIDEADLMFE-MGFIDDIKIILAQTSNRKITGLFSATIPEEIRKVVKDFITNYEEIEA 190
10 -79.700d2pl3a1 c.37.1.0 (A:47-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  23TRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFLVPVLEAL-TSTDGLGVLIISPTRELAYQTFEVLRKVGKNH-DFSAGLIIGGKDLKHEAERINN--INILVCTPGRLLQHMDETSFHATDLQMLVLDEADRILD-MGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLARLSLKNPEYVWV 230
11 -76.600d2i4ia3 c.37.1.0 (A:168-406) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  13ESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIGRRKQYPISLVLAPTRELAVQIYEEARKFSYRS-RVRPCVVYGGADIGQQIRDLERGC-HLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLD-MGFEPQIRRIVEQDTGVRHTMMFSATFPKEIQMLARDFLDEYIFLAV 238
12 -75.700d5gvra_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  29  13KSFKEMKFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRPYGLIICPSRELARQTHGILEYYCRLLPLLRCALCIGGMSVKEQMETIRHGV-HMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMID-MGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINV 230
13 -74.500d3iuya1 c.37.1.0 (A:213-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  22...DAFQQYPDLLKSIIRVGILKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPISREMLVLTPTRELALHVEAECSKYSY--KGLKSICIYGGRNRNGQIEDISKGV-DIIIATPGRLNDLQMNNSVNLRSITYLVIDEADKMLD-MEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALSYLKDPMIVYV 227
14 -74.000d3dkpa1 c.37.1.0 (A:139-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  26  30...QEYKINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLQPANKGFRALIISPTRELASQIHRELIKISEGT-GFRIHMIHKAAVAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPIDLASVEWLVVDESDKLFEKTGFRDQLASIFLACSHKVRRAMFSATFAYDVEQWCKLNLDNVISVSI 238
15 -53.800d1gkub1 c.37.1.16 (B:6-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  15  17CLFPEDFLLKEFVE-FFRKCVGEPRAIQKMWAKRILRKESFAATAPTGVGKTSFGLAMSLFLAL---KGKRCYVIFPTSLLVIQAAETIRKYAEKAGENLIGYYHGRIPKREKENFMQNRNFKIVITTTQFLSKHYRE----LGHFDFIFVDDVDAILKALGFHYDLKTKSWVGEARGCLMVSTATAKKGKKAELFRQLLN...... 223
16 -27.700d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  17  9......SISSYAVGILKEEGIEELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREA---IKGGKSLYVVPLRALAGEKYESFKKWEKI--GLRIGISTGDYESRDE----HLGDCDIIVTTSEKADSLIRNRASWIKAVSCLVVDEI-HLLDSEKRGATLEILVTKMNKALRVIGLSATAPN.................. 184
17 -22.500d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  17  9......................QPRIYQEVIYAKCKE-TNCLIVLPTGLGKTLIAMMIAEYRLTKYGG--KVLMLAPTKPLVLQHAESFRRLFN-LPPEKIVALTGEKSPEERSKAWARA--KVIVATPQTIENDLLAGRISLEDVSLIVFDEAHRAVGNYAYVFIAREYKRQAKNPL-VIGLTASPGSTPEKIME........... 175
18 -21.700d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  14  113......................EPHWYQKDAVFEGLVNRRRILNLPTSAGRSLIQALLARYYL--ENYEGKILIIVPTTALTTQMADDFVDYRL-FSHAMIKKIGGGASKDDKYKNDAP----VVVGTWQTVVKQPKE----FSQFGMMMNDECHLATG-----KSISSIISGLNNCMFKFGLSGSLRDG................. 265
19 -20.500d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  2AQAEVLNLESGAKQVLQETGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPALLL---------TVVVSPLISLMKDQVDQLQANG--VAAACLNSTQTREQQLEVMTGCRTGQIRLLYIAPERLMLDNFLEHLAHWNPVLLAVDEA-HCISQWGFRPEYAALLRQRFPTLPFMALTATADDTTRQ.............. 190
20 -17.100d1yksa1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}  ali model 3D-neighbors follow..  14  1.................................MLKKGMTTVLDFHPGAGKTRRFLPQILAEC---RRRLRTLVLAPTRVVLSEMKEAFHGLDVKFH--------------QAFSAHGSGREVIDAMCHATLTYRMLEPT-RVVNWEVIIMDEAHFLDPASIAARGWAAHRARA-NESATILMTATPP................... 138
21 -14.800d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  18  70......................SLRDYQEKALERWLVDKRGCIVLPTGSGKT------HVAMAAINELSTPTLIVVPTLALAEQWKERLGIFG----EEYVGEFSGR----------IKELKPLTVST---YDSAYVNAEKLGNRFMLLIFDEVHHL------AESYVQIAQMSIAPFRLGL-TAT..................... 204
22 -14.700d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  21  85........................TNAQKRAHQEIRNDMNRLLQGDVGSGKTVVAQLAILDNYE---AGFQTAFMVPTSILAIQHYRRTVESFSKF-NIHVALLIGATTPSEKKSGLRNGQIDVVIGTHALI-----QEDVHFKNLGLVIIDEQHR------FGVKQREALMNKGKMVDTLVMSATPIPRSMALA............ 249
23 -14.500d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors follow..  17  7....................................SFQVAHLHAPTGSGKSTKVPAAYAAQ--------KVLVLNPSVAATLGFGAYMSKAHGVDPNIRT--------------RTITTGSPITYSTYGKFL---ADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATAT..................... 135
24 -13.200d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  55......................ETTPDQAQAINAVLSDMDRLVCGDVGFGKTEVAMRAAFLAVDNHK---QVAVLVPTTLLAQQHYDNFDRFANWPVRIEMISRFRSAKEQTQLAEVAEGKIDILIGT-----HKLLQSDVKFKDLGLLIVDEEHR------FGVRHKERIKAMRANVDILTLTATPIPRTLNMAMSGMRDLSIIAT 233
25 -12.700d5y4za1 c.37.1.14 (A:178-481) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}  ali model 3D-neighbors follow..  12  9....................................KKQLTVLDLHPGAGKTRRVLPEIVRE----KKRLRTVILAPTRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEI-------------VDLMCHATFTSRLLQPI-RVPNYNLNIMDEAHSSIAARGYISTRVE------GEAAAIFMTATPPGTRDAFPDS.......... 152
26 -11.500d3kx2a1 c.37.1.19 (A:1-270) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 559292]}  ali model 3D-neighbors follow..  18  99...........................RDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVAE--------EMDVKLGEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDH-DLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATL--DAEKFQRYFNDAPL.... 264
27 -9.890d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  17  13............LRPYQIKGFSWMRFMNKLGFGICLAD-------DMGLGKTLQ-TIAVFSDAKKENELTPSLVICPLS-----LKNWEEELSKFAPHLRFAVFHEDR------SKIKLEDYDIILTTYAVLL---RDTRLKEVEWKYIVIDEAQNIKNP---QTKIFKAVKELKSKYRIALTGTPIENKVDDL............. 170
28 -9.790d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  1..................................................................GIRFEWVRVDLPEIYKEVRKLLREMLRDALKPLAETGLLESSSPDIPKKEVLRAG-QIINEEMAKGNHDLRGLLLYHAMA--LKLHHAIELLE-TQGLSALRAYIKKLYEEAKAGSTKAS---------KEIFSDKRMKKA 128
29 -9.590d2gk6a1 c.37.1.19 (A:295-324,A:416-702) Upf1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  88........................NHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNG--PVLVCAPSNIAVDQLTEKIHQTGAIDSPVSFLALHNQIRNMDSMPELQKMNADVICCT----CVGAGDPRLAKMQFRSILIDESTQATEP-------ECMVPVVLGAKQLILVG....................... 277

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.