current user: public

If you have questions about the server, please let us know.

Query: d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst MLGILNKMFDPTKRTLNRYEKIANDIDAIRGDYENLSDDALKHKTIEFKERLEKGATTDDLLVEAFAVVREASRRVTGMFPFKVQLMGGVALHDGNIAEMKTGEGKTLTSTLPVYLNALTGKGVHVVTVNEYLASRDAEQMGKIFEFLGLTVGLNLNSMSKDEKREAYAADITYSTNNELGFDYLRDNMVLYKEQMVQRPLHFAVIDEVDSILIDEARTPLIISGQXSMTLATITFQNYFRMYEKLAGMTGTAKTEEEEFRNIYNMQVVTIPTNLast
1 -123.000d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors  100  1MLGILNKMFDPTKRTLNRYEKIANDIDAIRGDYENLSDDALKHKTIEFKERLEKGATTDDLLVEAFAVVREASRRVTGMFPFKVQLMGGVALHDGNIAEMKTGEGKTLTSTLPVYLNALTGKGVHVVTVNEYLASRDAEQMGKIFEFLGLTVGLNLNSMSKDEKREAYAADITYSTNNELGFDYLRDNMVLYKEQMVQRPLHFAVIDEVDSILIDEARTPLIISGQXSMTLATITFQNYFRMYEKLAGMTGTAKTEEEEFRNIYNMQVVTIPTN 274
2 -12.900d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  11  112............................................................................IEPHWYQKDAVFEGLVNRRRILNLPTSAGRSLIQALARYYLENYEGKILIIVPTTALTTQMADDFVDYRLFSHAMIKKIGGGASKDDKYKN-DAPVVVGTWQTV----------VKQPKEWFSQFGMMMNDECHLA----------------TGKSISSIISGLNNCMFKFGLSGSLRDGKANIMQYVGFGEIFKP.. 282
3 -12.900d1gkub1 c.37.1.16 (B:6-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  21  38...............................................................................EPRAIQKMWAKRILRKEAATAPTGVGKTSFGLAMSLFLALKGKRCYVIFPTSLLVIQAAETIRKYAEKAGVGTGRIPKREKENFMQNLRNFKIVITTTQFLSKHYRE-----------LGHFDFIFVDDVDAILKASKNVDKLLH.................................................. 181
4 -11.300d1tf5a1 a.162.1.1 (A:227-348) Pre-protein crosslinking domain of SecA {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  62.................................................................................................................................................................................HHINQALKAHVAMQKDVDYVVEDGQVVIVDSFTGRLMKGRRYSEGLHQAIEAKEG.......................................... 116
5 -11.000d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  22  26..............................................................................LFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREAIKGGKSLYVVPLRALAGEKYESFKK-WEKIGLRIGISTGDYES-RDEHLGDCDIIVTTSEKA------DSLIRNRASWI-KAVSCLVVDEIH-LLDSEKRGATL.................................................... 159
6 -10.800d3dkpa1 c.37.1.0 (A:139-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  52................................................................................PIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQPANALIISPTRELASQIHRELIKISEGTGFRIHMIHKAAVAAKKKSSKKFDILVTTPNR-----LIYLLKQDPPGIDLASVEWLVVDESDKLFEDGK......................................................... 190
7 -10.700d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  14  8............................................................................IQPRIYQEVIYAK-CKETNCLIVLPTGLGKTLIAMMIAERLTKYGGKVLMLAPTKPLVLQHAESFRRLFNLPPEKIVALTGEKSPEERSKAWARAKVIVATPQTIENDLLAGRIS------LEDVSLIVFDEAHRAVGNYAYVFIA------------REYKRQAKNPLVIGLTASPGSTPEKIMEVNNLGIEHIEY. 187
8 -10.700d2pl3a1 c.37.1.0 (A:47-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  4..........................RESISRLMQNYEKINVNEITRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGA----------AKTGSGKTLAFLVPVL-TSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGGKDLKHEAERINNNILVCTPGRL-------QHMDETVSFHATDLQMLVLDEADRILLPKKRQTLLFSATQTKSVKDLA....................................... 218
9 -10.600d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  13  68...........................................................................EISLRDYQEKALERWLVDKRGCIVLPTGSGKTHVAMAAI---NELSTPTLIVVPTLALAE---QWKERLGIFGEEYVGEFSGRIKELK-------PLTVSTYDSA----------YVNAEKLGNRFMLLIFDEVHHLPAEIAPFRLGLTATFE.............................................. 206
10 -10.300d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  15  69.....................................................EGKLAEEFIKSLPFKLTNAQKRAHQEIRNDMISEKPM----NRLLQGDVGSGKTVVAQLAILDNYEAGFQTAFMVPTSILAIQHYRRTVESFSKFNIHVALLIGATTPSEKEKIKSG------LRNGQIDVVIGTHALIQEDVHFKNLGLVIIDE--EALMNKGKMVDTLV------------------------MSATPIPRSMALAFYGDLDVTVI... 259
11 -9.610d3bera_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  39................................................................................KIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDSMSQSLALAKKPHIIIATP-----LIDHL-ENTKGFNLRALKYLVMDEADRILIPRDRKTFLFSATMTKKVQKLQ....................................... 206
12 -9.260d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1......................................................................EIIQITTGSKELDKLLQGG--IETGSITEMEFRTGKTVTCQLPIDRGGGEGKAMYIDTEGTFRPER----LLAVAERYGLSGSDVLD---------------NVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTD------YSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVA............ 174

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.