current user: public
If you have questions about the server, please let us know.

Query: d1ugoa1 a.7.7.1 (A:8-93) BAG-family molecular chaperone regulator-5, BAG-5 {Mouse (Mus musculus) [TaxId: 10090]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst MDMGNQHPSISRLQEIQREVKAIEPQVVGFSGLSDDKNYKRLERILTKQLFEIDSVDTEGKGDIQQARKRAAQETERLLKELEQNALast
1 -45.200d1ugoa1 a.7.7.1 (A:8-93) BAG-family molecular chaperone regulator-5, BAG-5 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors  100  1MDMGNQHPSISRLQEIQREVKAIEPQVVGFSGLSDDKNYKRLERILTKQLFEIDSVDTEGKGDIQQARKRAAQETERLLKELEQNA 86
2 -41.200d1m62a1 a.7.7.1 (A:376-457) Silencer of death domains, Sodd (Bag4) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  38  1.....TPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKG 81
3 -28.400d3ldqb1 a.7.7.1 (B:151-260) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  1.NSPQEEVELKKLKHLEKSVEKIADQLEELNKCKLDRRVKATIEQFMKILEEIDTLILPENKDSRLKRKGLVKKVQAFLAECDT.. 103
4 -23.900d1t7sa_ a.7.7.1 (A:) BAG-family molecular chaperon regulator-1, BAG1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}  ali model 3D-neighbors follow..  14  27..........HNLSNLQKAYDLNLRDVADLERKKLEKKVKYFNEEAERHLETLDGMNINQAKRNREKRKTLVNGIQTLLNQNDA.. 119
5 -6.110d1nzea_ a.24.18.1 (A:) Oxygen-evolving enhancer protein 3, {Spinach (Spinacia oleracea) [TaxId: 3562]}  ali model 3D-neighbors follow..  13  6..........LPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRAYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAA 85
6 -5.700d5u8ja2 a.4.5.0 (A:85-171) automated matches {Enterobacter cloacae [TaxId: 550]}  ali model 3D-neighbors follow..  11  14..........................................AEVAVITTLLLRGAQTPGELRTRASRMHEFADMQEVEQTLDGLA 57
7 -5.670d3bz6a2 a.4.5.75 (A:97-180) Hypothetical protein PSPTO2686 {Pseudomonas syringae pv. tomato [TaxId: 323]}  ali model 3D-neighbors follow..  13  10..........................................AQVILTGLLLLRGPQTVSELLTRSNRMHDFEDSEQVVHQLERLI 53
8 -5.540d3rf3b2 a.24.9.1 (B:129-258) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  9  1..........AEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHR--VMLVNSMNTVKELL 74
9 -4.630d2f3ia_ b.40.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  1.........................................MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILD... 42
10 -4.570d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  151...DPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLL-LLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEM.... 228
FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 9 1 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.