current user: public

If you have questions about the server, please let us know.

Query: d1v8ca1 d.15.3.1 (A:1-87) MoaD-related protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
1 -52.400d1v8ca1 d.15.3.1 (A:1-87) MoaD-related protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors  100  1PKVNLYATFRDLTGKSQLELPGATVGEVLENLVRAYPALKEELFEGEGLAERVSVFLEGRDVRYLQGLSTPLSPGATLDLFPPVAGG 87
2 -36.100d2k9xa_ d.15.3.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}  ali model 3D-neighbors follow..  19  8.TVQFAGGCELLFAKQTSL-TGTNLNGLVQLLKTNYVKERPDLLTGQTLRPGILVLVNSCDAEVVGGMDYVLNDGDTVEFISTLHGG 102
3 -35.200d2qjla_ d.15.3.0 (A:) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  16  5.KVEFLGGLDAIFGKQRVH-DPVTVGDLIDHIVSTMINNPNDVSEDDSIRPGIITLINDTDWELEGEKDYILEDGDIISFTSTLHGG 99
4 -31.400d1vjka1 d.15.3.1 (A:2-88) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  30  4.KVKYFARFRQLAGVDEEEIEGARVRDLIEEIKKRHEKFKEEVFGEGYEDADVNIAVNGRYV----SWDEELKDGDVVGVFPPVS.. 87
5 -30.700d1fm0d_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  25  3.KVLFFAQVRELVGTDAVAADFPTVEALRQHMAAQSDRWALALEDGK-----LLAAVNQTLVSF----DHPLTDGDEVAFFPPVTGG 81
6 -15.300d5ldab_ d.15.3.2 (B:) Hypothetical protein PF1061 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  18  1.......KVKVIGRNIEKEIEGMKVRDILRAVGFN--------------TESAIAKVNGKVVLE----DDEVKDGDFVEVIPVVSGG 65
7 -13.600d1zud2_ d.15.3.2 (2:) Thiamin biosynthesis sulfur carrier protein ThiS {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  24  4...........FNDQAMQCAAGQTVHELLEQLDQR--------------QAGAALAINQQIVPREQWAQHIVQDGDQILLFQVIAGG 65
8 -12.600d2cu3a1 d.15.3.2 (A:1-63) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  25  4............LNGEPRPLEGKTLKEVLEEMGVE--------------LKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVALMQG. 63
9 -12.500d1ryja_ d.15.3.2 (A:) Hypothetical protein MTH1743 {Methanobacterium thermoautotrophicum [TaxId: 145262]}  ali model 3D-neighbors follow..  22  22....................APRRIKDVLGELEIP--------------IETVVVKKNGQIVID----EEEIFDGDIIEVIRVIYGG 70
10 -10.900d1tygb_ d.15.3.2 (B:) Thiamin biosynthesis sulfur carrier protein ThiS {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  3.......................QLNGKDVKWKKDTGTIQDLLASYQLENKIVIVERNKEIIGKERYHEVELCDRDVIEIVHFVGG. 65

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.