current user: public
If you have questions about the server, please let us know.

Query: d1vcsa1 a.47.2.1 (A:8-96) Vesicle transport v-SNARE protein Vti1-like 2 {Mouse (Mus musculus) [TaxId: 10090]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst EGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEARELLEQMDLEVREIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIALast
1 -43.600d1vcsa1 a.47.2.1 (A:8-96) Vesicle transport v-SNARE protein Vti1-like 2 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors  100  1EGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEARELLEQMDLEVREIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIA 89
2 -6.070d1hq1a_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  5NDFLEQLRQMKNGMASLMGKLPGMGQIPDNVKSQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAA--QDVNRLLKQFDDMQ.. 97
3 -5.890d3ldqb1 a.7.7.1 (B:151-260) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  51CKLDRRVKATIEQFMKILEEIDTLI-LKRKGLVKKVQAFLAECDTVEQNIC...................................... 109
4 -5.860d4xcod_ a.36.1.0 (D:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}  ali model 3D-neighbors follow..  10  11NELMTQLEAIENSMKKILSMIPGFGGAMPKELSHLTEAKIKKYKVIISSMTKEERENPKIIKASRIRRIAR--NDVREVLRYYETTK.. 103
5 -5.800d4jbea_ c.82.1.0 (A:) automated matches {Saccharomonospora viridis [TaxId: 471857]}  ali model 3D-neighbors follow..  7  1NEVAKAVEECARAAKSAAPSLSGAPDTAIDAALESMADRLLAHRDAVLAANAE-KAEAGGMSAGLLDRLTITESRLTDMADQLR..... 86
6 -5.590d4cr2o2 a.4.5.47 (O:278-387) Proteasome regulatory subunit Rpn9, C-terminal domain {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  12  32.....SFEDISKATHLPKDNVEHLVMRAISLGL--LKGSIDQVNELVTISWVQPRIISGDQITKMKDRLVEWNDQVEKLGKKMEA.... 109
7 -5.580d1eq1a_ a.63.1.1 (A:) Apolipophorin-III {Tobacco hornworm (Manduca sexta) [TaxId: 7130]}  ali model 3D-neighbors follow..  11  44KDGSDSVLQQLSAFSSSLQGAISDANGKAKEALEQARQNVEKTAEELRKAHPDVEKEANAFKDKLQAAVQTTVQESQKLAKEVAS.... 128
8 -5.430d1nu9c2 a.8.6.1 (C:146-281) Staphylocoagulase {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  14  33...DTQHKTEALELKAKVDLVLGDEDKPHRISNERIKEMIKDLESIIEDFFIETGLNKPDNITSYDSSKHHYKNHSEGFEALVKETR.. 117
9 -5.170d1t7sa_ a.7.7.1 (A:) BAG-family molecular chaperon regulator-1, BAG1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}  ali model 3D-neighbors follow..  13  61KKLEKKVKYFNEEAERHLETLDGMN-EKRKTLVNGIQTLLNQNDALLRRLQ...................................... 125
10 -5.020d1io1a_ e.32.1.1 (A:) Phase 1 flagellin {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  12  1...................NIKGLTQASRNSIAQTTEGALNEINNNLQRVELAVQSASQSDLDSIQAEITQRLNEIDRVSGQTQ..... 75
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Jaroszewski L, Rychlewski L, Godzik A. Improving the quality of twilight-zone alignments. Protein Sci. 2000 Aug;9(8):1487-96.